Recombinant Full Length Pts System Mannitol-Specific Eiicb Component(Mtla) Protein, His-Tagged
Cat.No. : | RFL19721SF |
Product Overview : | Recombinant Full Length PTS system mannitol-specific EIICB component(mtlA) Protein (Q9KJ75) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Streptococcus mutans serotype c |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MERKSSLKVRVQKLGTSLSNMVMPNIGAFIAWGVAASLFIATGYLPNKALDTNVVGPMLK YVLPLLIGYTGGYNIHKQRGGVIGAIASFGAIAGSTVTMFIGAMIMGPLSAWILKKFDEK VQPKIRTGFEMLVNNFSLGLIGFALMVLAFFVIGPVVAQLTEWVGIGVEAIVKVHLLPLA NLIIEPAKILFLNNALNHGIFTPLGTEQVAKVGKSVLFLLEANPGPGLGVLIAYAMFGKG SAKSSSWGAMIIHFFGGIHEIYFPYVMMKPAMFLAVIAGGLTGTFTFQTLGAGLTAPASP GSIIAIMGMSPKGWGPHLVVLAGVFAAAVASFLVASIILKSDNSDDDSLETAQAVTQAAK AESKGQAVTEPNLHSDITTDNIHQIIFACDAGMGSSAMGASILRDKVKKAGLDISVSNQA ISNLQDTANTLIVTQEELADRAGQKTPRAVHVAVDNFLATSKYDDIIASLTNGKASGSEN AAHSTQADSAEIDLNQIDAVVFAYGIAKGSATMGQETLRSIFKQNNVKIPVSTASYAHLS DYNAKNILLVTTIAQQGQAQQAAPNAQILVVDSLVTTPEYDKLVARMHK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mtlA |
Synonyms | mtlA; SMU_1185; PTS system mannitol-specific EIICB component; EIICB-Mtl; EII-Mtl |
UniProt ID | Q9KJ75 |
◆ Recombinant Proteins | ||
PRPS2-3750H | Recombinant Human PRPS2 protein, GST-tagged | +Inquiry |
CDC25A-27898TH | Recombinant Human CDC25A | +Inquiry |
RFL1991TF | Recombinant Full Length Thioalkalivibrio Sp. Electron Transport Complex Protein Rnfe(Rnfe) Protein, His-Tagged | +Inquiry |
Replicase-4351T | Recombinant Tobacco mosaic virus Replicase protein, His-tagged | +Inquiry |
RNF115-7643M | Recombinant Mouse RNF115 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
SUOX-248G | Active Native Chicken Sulfite Oxidase | +Inquiry |
ADVag-281V | Active Native ADV Protein | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
C1q-01M | Native Monkey C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TUBA3C-659HCL | Recombinant Human TUBA3C 293 Cell Lysate | +Inquiry |
RAET1G-1462HCL | Recombinant Human RAET1G cell lysate | +Inquiry |
HBD-5621HCL | Recombinant Human HBD 293 Cell Lysate | +Inquiry |
Liver Cytoplasmic -139R | Rat Liver Cytoplasmic Lysate | +Inquiry |
LMF1-4714HCL | Recombinant Human LMF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All mtlA Products
Required fields are marked with *
My Review for All mtlA Products
Required fields are marked with *
0
Inquiry Basket