Recombinant Full Length Escherichia Coli Pts System Mannitol-Specific Eiicba Component(Mtla) Protein, His-Tagged
Cat.No. : | RFL32887EF |
Product Overview : | Recombinant Full Length Escherichia coli PTS system mannitol-specific EIICBA component(mtlA) Protein (P00550) (1-637aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-637) |
Form : | Lyophilized powder |
AA Sequence : | MSSDIKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPNETLAKLVGPMITYLL PLLIGYTGGKLVGGERGGVVGAITTMGVIVGADMPMFLGSMIAGPLGGWCIKHFDRWVDG KIKSGFEMLVNNFSAGIIGMILAILAFLGIGPIVEALSKMLAAGVNFMVVHDMLPLASIF VEPAKILFLNNAINHGIFSPLGIQQSHELGKSIFFLIEANPGPGMGVLLAYMFFGRGSAK QSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILGGGLVSPASPGSI LAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAATRRMQDMKAESK GASPLSAGDVTNDLSHVRKIIVACDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNL PPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTANEEKVKD SLKDSFDDSSANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREK LTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEH IQVITSLTNALDDESVIERLAHTTSVDEVLELLAGRK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mtlA |
Synonyms | mtlA; b3599; JW3573; PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl [Includes: Mannitol permease IIC component; PTS system mannitol-specific EIIC component; Mannitol-specific phosphotransferase enzyme IIB component; PTS system mannitol |
UniProt ID | P00550 |
◆ Recombinant Proteins | ||
Cdk12-563F | Recombinant Fruit fly Cdk12 protein, His&Myc-tagged | +Inquiry |
SCO1321-459S | Recombinant Streptomyces coelicolor A3(2) SCO1321 protein, His-tagged | +Inquiry |
TLK1-2081H | Recombinant Human TLK1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HNRNPH1-21H | Recombinant Human HNRNPH1 Protein | +Inquiry |
MSTN-4363H | Recombinant Horse MSTN protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FABP-176P | Native Porcine Fatty acid Binding Protein | +Inquiry |
C7-56H | Native Human Complement C7 | +Inquiry |
Collagen Type I & III-05C | Native Canine Collagen Type I and III Protein | +Inquiry |
F2-276B | Active Native Bovine α-Thrombin-FPRck (FPR-CMK*) | +Inquiry |
MBLG-167B | Native Bovine milk β-Lactoglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF9-1808HCL | Recombinant Human SLAMF9 293 Cell Lysate | +Inquiry |
HCFC1R1-5614HCL | Recombinant Human HCFC1R1 293 Cell Lysate | +Inquiry |
NXF2-3621HCL | Recombinant Human NXF2 293 Cell Lysate | +Inquiry |
ITM2A-5118HCL | Recombinant Human ITM2A 293 Cell Lysate | +Inquiry |
Spleen-118M | Mouse Spleen Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mtlA Products
Required fields are marked with *
My Review for All mtlA Products
Required fields are marked with *
0
Inquiry Basket