Recombinant Full Length Staphylococcus Haemolyticus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL7779SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q4L6C5) (1-453aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-453) |
Form : | Lyophilized powder |
AA Sequence : | MIKKGTLKYKWMMITTLIMFSTIILFCLVIIFFLKDTLRDGEIDEAEHSSSEIVNLVESR SMNNITTLDLTAMLENFEKAIIYDRNGKQLMQSSNENMINFKPDIDFVDPETIQISKHNG IPYLIITEPIHSERFEGYSVLIHSLEGYNNVVRSLYFVAIAFGLLATFIMAGISYIFSTQ LTKPLVTMSNKMIQIRRDGFQNKLELKTNYEETDNLIDTFNDMMYQIEESFNQQRQFVED ASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISLEEMNRITKLVEELLLLTKDKVN IQALEFEEVNINEEIRSRIKSLKQLHPDYQFKTHLSKKPLTLQINRHQFEQLLLIFIDNA MKYDKDNKQIEIATQLRNKQISIEITDHGLGIPKEDQEFIFDRFYRVDKSRSRSQGGNGL GLFIAEKIVQQYGGYITVDSEVNQYTTFKIIFK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SH1491; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q4L6C5 |
◆ Recombinant Proteins | ||
GOT1-1495H | Recombinant Human GOT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TNFSF15-1829R | Recombinant Rhesus Monkey TNFSF15 Protein | +Inquiry |
CD300C-3100HF | Recombinant Full Length Human CD300C Protein | +Inquiry |
Osm-8302M | Active Recombinant Mouse Osm | +Inquiry |
AMT-301238H | Recombinant Human AMT protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
IgG-151M | Native Mouse IgG Fab fragment | +Inquiry |
C-type lectin like protein-042H | Native Hen C-type lectin like protein Protein, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAIAP2-8521HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
GPR176-744HCL | Recombinant Human GPR176 cell lysate | +Inquiry |
IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
BTG4-193HCL | Recombinant Human BTG4 cell lysate | +Inquiry |
ESRP1-6538HCL | Recombinant Human ESRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket