Recombinant Full Length Staphylococcus Saprophyticus Subsp. Saprophyticus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL14817SF |
Product Overview : | Recombinant Full Length Staphylococcus saprophyticus subsp. saprophyticus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q49XM6) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus saprophyticus subsp. saprophyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MKQRKLKTKWMLITTTITFLTIFLFSIIIIFFLSNSLRHNEVDEAERSSEDIVKLFESKQ IEHVTPLDLNASLGNFQKVMLFNEDGHKLMETSNDNSITFSPNIVPTNVNRIAVKSDHKK DYLIITDHIESPKFNGYSVIVHSLEDYKALVNSLYFIALIFGVIATFITAIISYFFSSQI TKPLILMSNKMQQIRRDGFQEKVELSTNYEETDNLIVTFNEMMLQLEESFNQQRQFVEDA SHELRTPLQIIQGHLNLINRWGKKDAAILEESLDISLEEMTRITKLVEELLLLTKDNNNS RDGEIENVEINQEIASRIKSLSQLHSDYTFEFDAFPKPLNIKIDRYQFEQMLIIFIDNAM KYDQINKYIQIQTKLRNKQISIEITDHGVGIPKEDIEFIFDRFYRVDKSRSRKLGGNGLG LSIAKKIIELNNGTIHVDSEVDKYTTFKITF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SSP1324; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q49XM6 |
◆ Recombinant Proteins | ||
CD40-3827H | Active Recombinant Human CD40 Protein, hFc-tagged, Site-specific Alexa Fluor 647-Labeled | +Inquiry |
ATL3-2648H | Recombinant Human ATL3 Protein, GST-tagged | +Inquiry |
FZD4-4592H | Recombinant Human FZD4 Protein | +Inquiry |
TGFB1 & GARP-2196H | Recombinant Human TGFB1(Leu30-Ser390) & GARP(His20-Leu628(Y137H)) Protein, His-Avi-tagged | +Inquiry |
RFL-21796MF | Recombinant Full Length Mouse Type-2 Angiotensin Ii Receptor(Agtr2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
TG-31519TH | Native Human TG | +Inquiry |
LDL-393H | Native Human Low Density Lipoprotein | +Inquiry |
PNLIP-8203H | Native Human Pancreatic Lipase | +Inquiry |
CGB-8048H | Native Human Urine Beta Chorionic Gonadotropin (b-hCG) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARRDC1-8678HCL | Recombinant Human ARRDC1 293 Cell Lysate | +Inquiry |
ABRA-9121HCL | Recombinant Human ABRA 293 Cell Lysate | +Inquiry |
ZNF180-132HCL | Recombinant Human ZNF180 293 Cell Lysate | +Inquiry |
C9orf37-7931HCL | Recombinant Human C9orf37 293 Cell Lysate | +Inquiry |
GCC1-691HCL | Recombinant Human GCC1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket