Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL4368SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q2FH24) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SAUSA300_1307; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q2FH24 |
◆ Recombinant Proteins | ||
MRPL57-11037Z | Recombinant Zebrafish MRPL57 | +Inquiry |
NEK5-10575M | Recombinant Mouse NEK5 Protein | +Inquiry |
ETNK2-3433Z | Recombinant Zebrafish ETNK2 | +Inquiry |
ARAF-32H | Recombinant Human ARAF protein, GST-tagged | +Inquiry |
POLB-6903M | Recombinant Mouse POLB Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1770D | Active Native Dolichos Biflorus Lectin Protein, Fluorescein labeled | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
Pepsin-41P | Active Native Porcine Pepsin | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
Annexin-V-009H | Native Human Annexin-V Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC15-8346HCL | Recombinant Human C11orf51 293 Cell Lysate | +Inquiry |
ZNF747-16HCL | Recombinant Human ZNF747 293 Cell Lysate | +Inquiry |
TBC1D14-1229HCL | Recombinant Human TBC1D14 293 Cell Lysate | +Inquiry |
SENP8-1970HCL | Recombinant Human SENP8 293 Cell Lysate | +Inquiry |
CXXC5-7149HCL | Recombinant Human CXXC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket