Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL20852SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q7A0W5) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; MW1304; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q7A0W5 |
◆ Recombinant Proteins | ||
BR1-2783H | Recombinant Human BRat 1 Protein, MYC/DDK-tagged | +Inquiry |
FHIT-2344R | Recombinant Rat FHIT Protein | +Inquiry |
RFL22124SF | Recombinant Full Length Sinorhizobium Medicae Probable Intracellular Septation Protein A (Smed_3090) Protein, His-Tagged | +Inquiry |
KLHL17-2935R | Recombinant Rat KLHL17 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC4C-2214H | Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
Luciferase-09F | Active Native Firefly Luciferase | +Inquiry |
TF-261M | Native Monkey Transferrin | +Inquiry |
A2m-8030M | Native Mouse A2m | +Inquiry |
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYSMD2-1043HCL | Recombinant Human LYSMD2 cell lysate | +Inquiry |
EBF1-6736HCL | Recombinant Human EBF1 293 Cell Lysate | +Inquiry |
ARIH2-8725HCL | Recombinant Human ARIH2 293 Cell Lysate | +Inquiry |
MRPL21-4188HCL | Recombinant Human MRPL21 293 Cell Lysate | +Inquiry |
DSCC1-6812HCL | Recombinant Human DSCC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket