Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL31183SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q7A2R7) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SAV1414; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q7A2R7 |
◆ Recombinant Proteins | ||
WNEnvelopeM-156H | Recombinant Human West Nile Envelope M Protein, His-tagged | +Inquiry |
CCL27-517R | Recombinant Rhesus Macaque CCL27 Protein, His (Fc)-Avi-tagged | +Inquiry |
NDFIP1-5952M | Recombinant Mouse NDFIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Il1f8-647M | Recombinant Mouse Il1f8 protein | +Inquiry |
IL1B-2827D | Recombinant Dog IL1B protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
VWF-17H | Native Human von Willebrand Factor, Factor VIII Free | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
HP-8153H | Native Human Serum Haptoglobin | +Inquiry |
DD-170H | Active Native Human D-Dimer | +Inquiry |
HBB-001H | Native Human Hemoglobin S, Ferrous Stabilized | +Inquiry |
◆ Cell & Tissue Lysates | ||
NNMT-3779HCL | Recombinant Human NNMT 293 Cell Lysate | +Inquiry |
PCBD1-3405HCL | Recombinant Human PCBD1 293 Cell Lysate | +Inquiry |
DCBLD2-868HCL | Recombinant Human DCBLD2 cell lysate | +Inquiry |
P2RY12-3491HCL | Recombinant Human P2RY12 293 Cell Lysate | +Inquiry |
HPRT1-5398HCL | Recombinant Human HPRT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket