Recombinant Full Length Staphylococcus Epidermidis Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL27276SF |
Product Overview : | Recombinant Full Length Staphylococcus epidermidis Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q5HPC4) (1-456aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Epidermidis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-456) |
Form : | Lyophilized powder |
AA Sequence : | MIKRQKLKYKWMLITTLITFTTILLFCLIIIFFLKDTLRSSEIDEAERSSNDIANLFHSK SLSDISALDLNASLENFQEILIYDDKGRKLIQTSNDNTLAYDNKIDFKHPERIHIHRSHG INYLVITEPIRSKEFSGYSVLVHSLQNYDNLVKSLYIVALAFGLIATIITAGVSYIFSSQ ITKPIVTMSNKMNQIRRDGFQNKLELTTNYEETDNLIDTFNEMMYQIEESFNQQRQFVED ASHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEVNRITKLVEELLLLTKDRVN HNVLECENVDINSEIQSRVKSLQHLHPDYTFETHLATKPIQLKINRHQFEQLLLIFIDNA MKYDTEHKHIKIVTQLKNKMIMIDITDHGMGIPKADLEFIFDRFYRVDKSRARSQGGNGL GLSIAEKIVQLNGGMIQVESELQNYTTFKISFPVLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SERP0988; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q5HPC4 |
◆ Recombinant Proteins | ||
MYH6-1465H | Recombinant Human MYH6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sema5a-5762M | Recombinant Mouse Sema5a Protein, Myc/DDK-tagged | +Inquiry |
ARFGAP2-30760TH | Recombinant Human ARFGAP2, His-tagged | +Inquiry |
RFL30076RF | Recombinant Full Length Rat Ninjurin-2(Ninj2) Protein, His-Tagged | +Inquiry |
CTNNB1-2082H | Recombinant Human CTNNB1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
BCHE-157H | Active Native Horse Serum Butyrylcholinesterase | +Inquiry |
PLG-27925TH | Native Human PLG | +Inquiry |
C3b-06M | Native Mouse C3b Protein | +Inquiry |
C. jejuni-24 | Native Campylobacter jejuni Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKP1-1813HCL | Recombinant Human SKP1 293 Cell Lysate | +Inquiry |
Skin-849P | Pig Skin Membrane Lysate, Total Protein | +Inquiry |
FAM168A-6409HCL | Recombinant Human FAM168A 293 Cell Lysate | +Inquiry |
Intestine-613R | Rat Intestine whole Lysate, Total Protein | +Inquiry |
HSD17B4-5373HCL | Recombinant Human HSD17B4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket