Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL12829SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q9KJN3) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SAOUHSC_01419; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q9KJN3 |
◆ Recombinant Proteins | ||
TOMM34-5875R | Recombinant Rat TOMM34 Protein, His (Fc)-Avi-tagged | +Inquiry |
KDM4D-0534H | Recombinant Human KDM4D Protein (E2-P523), His tagged | +Inquiry |
Apoc1-2353M | Recombinant Mouse Apoc1 protein, His-tagged | +Inquiry |
Camk1g-1944M | Recombinant Mouse Camk1g Protein, Myc/DDK-tagged | +Inquiry |
TNFSF11-3253H | Active Recombinant Human TNFSF11 protein(Gly 63-Asp 244), rFc-tagged | +Inquiry |
◆ Native Proteins | ||
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
HP-127H | Native Human Hemoglobin protein | +Inquiry |
Prothrombin-59H | Native Human Prothrombin Frag 1 | +Inquiry |
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
SPARC-30653TH | Native Human SPARC | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM15-001HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
PARD3-1283HCL | Recombinant Human PARD3 cell lysate | +Inquiry |
POLR3C-3026HCL | Recombinant Human POLR3C 293 Cell Lysate | +Inquiry |
DHTKD1-475HCL | Recombinant Human DHTKD1 cell lysate | +Inquiry |
PRPF3-2827HCL | Recombinant Human PRPF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket