Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL26901SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q2YY04) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLHNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI DYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SAB1270c; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q2YY04 |
◆ Recombinant Proteins | ||
PRR23B-1737H | Recombinant Human PRR23B | +Inquiry |
NTRK1-297H | Recombinant Human NTRK1 Protein, DDK/His-tagged | +Inquiry |
STAG2A-5829Z | Recombinant Zebrafish STAG2A | +Inquiry |
RFL27925BF | Recombinant Full Length Brucella Suis Biovar 1 Phosphatidate Cytidylyltransferase(Cdsa) Protein, His-Tagged | +Inquiry |
DDX41-35H | Recombinant Human DDX41 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Annexin-013 | Native Annexin Protein, Gold conjugated | +Inquiry |
Lectin-1776G | Active Native Galanthus Nivalis Lectin Protein, Agarose bound | +Inquiry |
slo-01S | Active Native Streptococcus pyogenes Streptolysin O protein | +Inquiry |
SERPINA7-30623TH | Native Human SERPINA7 | +Inquiry |
CA2-35R | Native Rhesus monkey Carbonic Anhydrase II (CA2) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3B-999MCL | Recombinant Mouse REG3B cell lysate | +Inquiry |
GTSF1-5679HCL | Recombinant Human GTSF1 293 Cell Lysate | +Inquiry |
STRAP-642HCL | Recombinant Human STRAP lysate | +Inquiry |
PEX13-3292HCL | Recombinant Human PEX13 293 Cell Lysate | +Inquiry |
OSBPL9-3529HCL | Recombinant Human OSBPL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket