Recombinant Full Length Staphylococcus Aureus Signal Transduction Histidine-Protein Kinase Arls(Arls) Protein, His-Tagged
Cat.No. : | RFL30436SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Signal transduction histidine-protein kinase ArlS(arlS) Protein (Q6G9E7) (1-451aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-451) |
Form : | Lyophilized powder |
AA Sequence : | MTKRKLRNNWIIVTTMITFVTIFLFCLIIIFFLKDTLHNSELDDAERSSSDINNLFHSKP VKDISALDLNASLGNFQEIIIYDEHNNKLFETSNDNTVRVEPGYEHRYFDRVIKKRYKGI EYLIIKEPITTQDFKGYSLLIHSLENYDNIVKSLYIIALAFGVIATIITATISYVFSTQI TKPLVSLSNKMIEIRRDGFQNKLQLNTNYEEIDNLANTFNEMMSQIEESFNQQRQFVEDA SHELRTPLQIIQGHLNLIQRWGKKDPAVLEESLNISIEEMNRIIKLVEELLELTKGDVND ISSEAQTVHINDEIRSRIHSLKQLHPDYQFDTDLTSKNLEIKMKPHQFEQLFLIFIDNAI KYDVKNKKIKVKTRLKNKQKIIEITDHGIGIPEEDQDFIFDRFYRVDKSRSRSQGGNGLG LSIAQKIIQLNGGSIKIKSEINKGTTFKIIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | arlS |
Synonyms | arlS; SAS1357; Signal transduction histidine-protein kinase ArlS |
UniProt ID | Q6G9E7 |
◆ Recombinant Proteins | ||
CD86-139CAF555 | Recombinant Cynomolgus CD86 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Wars2-1274M | Recombinant Mouse Wars2 protein, His & T7-tagged | +Inquiry |
ABCC12-1099M | Recombinant Mouse ABCC12 Protein | +Inquiry |
SIGLEC5-7330H | Recombinant Human SIGLEC5 protein, hFc-tagged | +Inquiry |
NME7-49H | Recombinant Human NME7, GST-tagged | +Inquiry |
◆ Native Proteins | ||
HP-190C | Native Dog Haptoglobin | +Inquiry |
acetylated Albumin-007B | Native Bovine acetylated Albumin Protein | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
ALB-313B | Native Bovine Albumin, Texas Red Label | +Inquiry |
TF-391H | Native Human Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cerebellum-64R | Rhesus monkey Cerebellum (LT) Lysate | +Inquiry |
ARL6IP4-123HCL | Recombinant Human ARL6IP4 cell lysate | +Inquiry |
DYNC2LI1-6760HCL | Recombinant Human DYNC2LI1 293 Cell Lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
CCL6-1896MCL | Recombinant Mouse CCL6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arlS Products
Required fields are marked with *
My Review for All arlS Products
Required fields are marked with *
0
Inquiry Basket