Recombinant Full Length Staphylococcus Aureus Probable Ctpa-Like Serine Protease(Sar1432) Protein, His-Tagged
Cat.No. : | RFL19644SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Probable CtpA-like serine protease(SAR1432) Protein (Q6GGY8) (1-496aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-496) |
Form : | Lyophilized powder |
AA Sequence : | MDDKQHTTSSDDERAENATSNQDQQTNSSKRVHLKRWQFISILIGTIIITAVITVVAYIF INQKISGLNKTDQANLNKIENVYKILNSDYYKKQNSDKLSKAAIDGMVKELKDPYSEYLT KEQTKSFNEGVSGDFVGIGAEMQKKNDQIMVTSPMKGSPAERAGIRPKDVITKVNGKSIK GKALDEVVKDVRGKENTEVTLTVQRGSEEKDVKIKREKIHVKSVEYKKKGKVGVITINKF QNDTSGELKDAVLKAHKDGLKKIVLDLRNNPGGLLDEAVKMANIFIDKGKTVVKLEKGKD TEAIQTSNDALKEAKDMDISILVNEGSASASEVFTGALKDYNKAKVYGSKTFGKGVVQTT REFKDGSLLKYTEMKWLTPDGHYIHGKGIKPDVTIDTPKYQSLNVIPNTKTFKVGDDDKN IKTIKIGLSALGYKVDNESTQFDQALENLVKAFQQANKLEVTGEFNKETNNKFTELLVEK ANKHDDVLDKLINILK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SAR1432 |
Synonyms | SAR1432; Probable CtpA-like serine protease |
UniProt ID | Q6GGY8 |
◆ Native Proteins | ||
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
Lectin-1808M | Active Native Maackia Amurensis Lectin I Protein, Fluorescein labeled | +Inquiry |
TPM-250H | Native Human Tropomyosin | +Inquiry |
PLG-268B | Active Native Bovine glu-Plasminogen | +Inquiry |
Factor B-60H | Native Human Factor B | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A & IL12B-1908HCL | Recombinant Human IL12A & IL12B cell lysate | +Inquiry |
MLLT3-4292HCL | Recombinant Human MLLT3 293 Cell Lysate | +Inquiry |
ZSCAN21-9185HCL | Recombinant Human ZSCAN21 293 Cell Lysate | +Inquiry |
TPST1-2100HCL | Recombinant Human TPST1 cell lysate | +Inquiry |
TAF1A-1273HCL | Recombinant Human TAF1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SAR1432 Products
Required fields are marked with *
My Review for All SAR1432 Products
Required fields are marked with *
0
Inquiry Basket