Recombinant Full Length Mouse Mitochondrial Import Inner Membrane Translocase Subunit Tim21(Timm21) Protein, His-Tagged
Cat.No. : | RFL4513MF |
Product Overview : | Recombinant Full Length Mouse Mitochondrial import inner membrane translocase subunit Tim21(Timm21) Protein (Q8CCM6) (19-249aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (19-249) |
Form : | Lyophilized powder |
AA Sequence : | LGRQLLPHFVFTKACFKTQPLRWGLREQKITVQPRTVLRFTQKTFWTQGPDPRKAKEDST KQVSIRRNQREETGVSMSQKVREAGRDVSYLIVVLFGVGLTGGLLYAIFKELFFSSSPNI IYGKALGKCRTHPEVSFLMIVLGRRCASLLKPMLSCFSVFRSHSLMHFDPGTVSYIHFSV VLSAPASSGLRHPSYKTILNQNVAKRVESWQRLHLGHYIVYRIQGILCGPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Timm21 |
Synonyms | Timm21; Tim21; Mitochondrial import inner membrane translocase subunit Tim21; TIM21-like protein, mitochondrial |
UniProt ID | Q8CCM6 |
◆ Recombinant Proteins | ||
MAP3K12-3221R | Recombinant Rat MAP3K12 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL4485CF | Recombinant Full Length Clostridium Acetobutylicum Membrane Protein Insertase Yidc(Yidc) Protein, His-Tagged | +Inquiry |
MTMR9-5791M | Recombinant Mouse MTMR9 Protein, His (Fc)-Avi-tagged | +Inquiry |
TRMT10B-17415M | Recombinant Mouse TRMT10B Protein | +Inquiry |
UFSP2-514H | Recombinant Human UFSP2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CLU-19H | Native Human Clusterin Protein | +Inquiry |
IGHE-214H | Native Human Immunoglobulin E (IgE) | +Inquiry |
KRT19-382H | Native Human KRT19 | +Inquiry |
ACTA1-157R | Native Rabbit skeletal muscle alpha Actin | +Inquiry |
MOMP-02C | Native C. trachomatis MOMP Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP11A1-7131HCL | Recombinant Human CYP11A1 293 Cell Lysate | +Inquiry |
Liver-104M | Mouse Liver Tissue Lysate (0 Days Old) | +Inquiry |
SK-N-SH-01HL | Human SK-N-SH lysate | +Inquiry |
C2orf83-8061HCL | Recombinant Human C2orf83 293 Cell Lysate | +Inquiry |
STARD10-1423HCL | Recombinant Human STARD10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Timm21 Products
Required fields are marked with *
My Review for All Timm21 Products
Required fields are marked with *
0
Inquiry Basket