Recombinant Human CFI protein(239-316aa), His-GST&Myc-tagged

Cat.No. : CFI-2741H
Product Overview : Recombinant Human CFI protein(P05156)(239-316aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : N-His-GST&C-Myc
Protein length : 239-316aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 43.4 kDa
AASequence : KACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERR
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name CFI complement factor I [ Homo sapiens ]
Official Symbol CFI
Synonyms CFI; complement factor I; I factor (complement) , IF; C3b INA; C3b inactivator; FI; KAF; Konglutinogen activating factor; C3b-inactivator; C3B/C4B inactivator; complement component I; light chain of factor I; Konglutinogen-activating factor; complement factor I heavy chain; complement control protein factor I; IF; AHUS3; C3BINA; C3b-INA;
Gene ID 3426
mRNA Refseq NM_000204
Protein Refseq NP_000195
MIM 217030
UniProt ID P05156

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CFI Products

Required fields are marked with *

My Review for All CFI Products

Required fields are marked with *

0

Inquiry Basket

cartIcon