Recombinant Human CFI protein(239-316aa), His-GST&Myc-tagged

• Cat.No.: CFI-2741H
• Product Overview: Recombinant Human CFI protein(P05156)(239-316aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-His-GST&C-Myc
• Protein length: 239-316aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 43.4 kDa
• AASequence: KACDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAGFASVTQEETEILTADMDAERR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CFI complement factor I [ Homo sapiens ]
• Official Symbol: CFI
• Synonyms: CFI; complement factor I; I factor (complement) , IF; C3b INA; C3b inactivator; FI; KAF; Konglutinogen activating factor; C3b-inactivator; C3B/C4B inactivator; complement component I; light chain of factor I; Konglutinogen-activating factor; complement factor I heavy chain; complement control protein factor I; IF; AHUS3; C3BINA; C3b-INA
• Gene ID: 3426
• mRNA Refseq: NM_000204
• Protein Refseq: NP_000195
• MIM: 217030
• UniProt ID: P05156