Recombinant Full Length Mouse Transmembrane Protein 232(Tmem232) Protein, His-Tagged
Cat.No. : | RFL1200MF |
Product Overview : | Recombinant Full Length Mouse Transmembrane protein 232(Tmem232) Protein (Q5K6N0) (1-675aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-675) |
Form : | Lyophilized powder |
AA Sequence : | MKAYKPPVVNKFGVISSTYHEELLKSIFESSNRRKSQKPKPSFSISKEFILRFNHTDNPA EEEELLEQARRLIVRSKRKLGLKTLGSGKHVHLPTAWAEVIYLAQCKGEIQDEALNMLHA SLDHVSFDHDQLPALFFLAESVLYRLCCDAFMKGYLYSVEIKLVKIGYLIFLRLFVFFLH GHLESFKQHLLRLQPYLYALHFSEPSYYKYPNIISNVQFILKTSEIICKRELHSEPFVES PDETEDPYSDLNHLQLNKRGYEVNHLLWHSVAAWSCVQNNRPQLTEVLEHLLFYKTQLQT KCWLDSALALMVLGEAAKLDMACLKTLMDLVTDFLENILSAQNQEENYNIYDTSWASEIV FTYTTIIAEVCLYAATSDLRKTALIGFCACKSPQQGISLTDKSEELPELDGASILTLLKY FSSRISDNCEKVIWIGYYGIVYNLVKMSWELQGEQDQDGLRNMIWQTLQKIKDYEQDPRI RCALVIAQAELNGPSDPFCTKATPNSGEEVFSKYIGWRIATTLSRLFFPSLDVAPPKTPV EVDLPRKHTIRERQPAKKRVLRFILKDHSSVVEVSMTPYPNFFTKADKKLEEIIDHHWQK DMEARKREEEAYKAQNQKDKEEKEKIHFQEIMKQRERKLNKQTKPYEIILSEKESGSEKK CGFFELKPSTAPNAK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tmem232 |
Synonyms | Tmem232; Tes13; Transmembrane protein 232; Testis-specific protein 13 |
UniProt ID | Q5K6N0 |
◆ Recombinant Proteins | ||
XPNPEP2-6574H | Recombinant Human XPNPEP2 Protein | +Inquiry |
LYNX1-SLURP2-1332H | Recombinant Human LYNX1-SLURP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAN2B1-2257Z | Recombinant Zebrafish MAN2B1 | +Inquiry |
RFL28700TF | Recombinant Full Length Tolumonas Auensis Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
ARHGAP6-4452H | Recombinant Human ARHGAP6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
C3-08R | Native Rat C3 Protein | +Inquiry |
Lectin-1855V | Active Native Vicia Villosa Lectin Protein, Agarose bound | +Inquiry |
FBb-16H | Native Human FBb protein | +Inquiry |
Interferon alfa-P029H | Native Human interferon alpha therapeutic protein (Interferon alfa-n3) | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Fetal Spleen-166H | Human Fetal Spleen Lysate | +Inquiry |
HA-2357HCL | Recombinant H5N3 HA cell lysate | +Inquiry |
DCUN1D5-7033HCL | Recombinant Human DCUN1D5 293 Cell Lysate | +Inquiry |
TTC4-674HCL | Recombinant Human TTC4 293 Cell Lysate | +Inquiry |
TOMM20-872HCL | Recombinant Human TOMM20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tmem232 Products
Required fields are marked with *
My Review for All Tmem232 Products
Required fields are marked with *
0
Inquiry Basket