Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL10436SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q99U09) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHETIKDAENNTEHSTVSDKSIAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSD KSNNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SAV1481; Elastin-binding protein EbpS |
UniProt ID | Q99U09 |
◆ Recombinant Proteins | ||
RFL23142SF | Recombinant Full Length Synechococcus Sp. Photosystem Ii Reaction Center Protein J(Psbj) Protein, His-Tagged | +Inquiry |
XRCC1-778HFL | Recombinant Full Length Human XRCC1 Protein, C-Flag-tagged | +Inquiry |
SSPH-1221B | Recombinant Bacillus subtilis SSPH protein, His-tagged | +Inquiry |
IMPA2-2264R | Recombinant Rhesus monkey IMPA2 Protein, His-tagged | +Inquiry |
NLRP3-3003H | Recombinant Human NLRP3 protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
MMP9-38H | Native Human MMP-9 | +Inquiry |
IgG-332S | Native Swine IgG | +Inquiry |
KLK3-8248H | Native Human Prostate Specific Antigen | +Inquiry |
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPD-2144HCL | Recombinant Human SFTPD cell lysate | +Inquiry |
MRTO4-225HCL | Recombinant Human MRTO4 cell lysate | +Inquiry |
Stomach-124M | Mouse Stomach Tissue Lysate (14 Day Old) | +Inquiry |
TMEM37-955HCL | Recombinant Human TMEM37 293 Cell Lysate | +Inquiry |
HBM-5618HCL | Recombinant Human HBM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket