Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL24022SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q2FYF1) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHDTIKNAENNTEHSTVSDKSEAEQSQQPKPYFTTGANQSETSK NEHDNDSVKQDQDEPKEHHNGKKAAAIGAGTAGVAGAAGAMAASKAKKHSNDAQNKSNSG KANNSTEDKASQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SAOUHSC_01501; Elastin-binding protein EbpS |
UniProt ID | Q2FYF1 |
◆ Native Proteins | ||
SNCA-27342TH | Native Human SNCA | +Inquiry |
C4-12H | Active Native Human C4 protein | +Inquiry |
TNNC1-25H | Native Human TNNC1 protein | +Inquiry |
MUC1-376H | Active Native Human MUC1 | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELP-001RCL | Recombinant Rat SELP cell lysate | +Inquiry |
USP22-464HCL | Recombinant Human USP22 293 Cell Lysate | +Inquiry |
ANTXR2-001MCL | Recombinant Mouse ANTXR2 cell lysate | +Inquiry |
RPS19-2169HCL | Recombinant Human RPS19 293 Cell Lysate | +Inquiry |
YEATS4-248HCL | Recombinant Human YEATS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket