Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL8808SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q6GGT1) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEGYYNKN AFAMDKSHPEPIEDNDKHETIKEAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSG KVNNSTEDKASEDKSKEHHNGKKGAAIGAGTAGLAGGAASNSASAASKPHASNNASQNND EHDHHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKDDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; SAR1489; Elastin-binding protein EbpS |
UniProt ID | Q6GGT1 |
◆ Recombinant Proteins | ||
Il6st-789M | Recombinant Mouse Il6st protein, His & T7-tagged | +Inquiry |
CWC27-1682R | Recombinant Rat CWC27 Protein | +Inquiry |
ANKRD34C-3481H | Recombinant Human ANKRD34C, His-tagged | +Inquiry |
SDC2-4944R | Recombinant Rat SDC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL2558SF | Recombinant Full Length Streptococcus Pneumoniae Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
PKLR-244R | Active Native Rabbit Pyruvate Kinase | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
Alpha Macroglobulin-86M | Native Mouse Alpha Macroglobulin | +Inquiry |
Insulin-04B | Native Bovine Insulin Protein | +Inquiry |
Collagen-121H | Native Human Collagen Type IV protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
GALNT9-6033HCL | Recombinant Human GALNT9 293 Cell Lysate | +Inquiry |
GRM4-5734HCL | Recombinant Human GRM4 293 Cell Lysate | +Inquiry |
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
GUCY1A3-5677HCL | Recombinant Human GUCY1A3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket