Recombinant Full Length Staphylococcus Aureus Elastin-Binding Protein Ebps(Ebps) Protein, His-Tagged
Cat.No. : | RFL14372SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Elastin-binding protein ebpS(ebpS) Protein (Q8NWM5) (2-486aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-486) |
Form : | Lyophilized powder |
AA Sequence : | SNNFKDDFEKNRQSIDTNSHQDHTEDVEKDQSELEHQDTIENTEQQFPPRNAQRRKRRRD LATNHNKQVHNESQTSEDNVQNEAGTIDDRQVESSHSTESQEPSHQDSTPQHEEEYYNKN AFAMDKSHPEPIEDNDKHETIKEAENNTEHSTVSDKSEAEQSQQPKPYFATGANQANTSK DKHDDVTVKQDKDESKDHHSGKKGAAIGAGTAGVAGAAGAMGVSKAKKHSNDAQNKSNSD KSNNSTEDKVSQDKSKDHHNGKKGAAIGAGTAGLAGGAASKSASAASKPHASNNASQNHD EHDNHDRDKERKKGGMAKVLLPLIAAVLIIGALAIFGGMALNNHNNGTKENKIANTNKNN ADESKDKDTSKDASKDKSKSTDSDKSKEDQDKATKDESDNDQNNANQANNQAQNNQNQQQ ANQNQQQQQQRQGGGQRHTVNGQENLYRIAIQYYGSGSPENVEKIRRANGLSGNNIRNGQ QIVIP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ebpS |
Synonyms | ebpS; MW1369; Elastin-binding protein EbpS |
UniProt ID | Q8NWM5 |
◆ Recombinant Proteins | ||
FBXW11-4700HF | Recombinant Full Length Human FBXW11 Protein, GST-tagged | +Inquiry |
WDR34-6030Z | Recombinant Zebrafish WDR34 | +Inquiry |
USP28-17917M | Recombinant Mouse USP28 Protein | +Inquiry |
KRTAP21-1-3281H | Recombinant Human KRTAP21-1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RRAS2-0508H | Recombinant Human RRAS2 Protein (M1-F204), Tag Free | +Inquiry |
◆ Native Proteins | ||
Lectin-1722C | Native Canavalia ensiformis Lectin, Biotin conjugated | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
HSP90-110H | Native Human HSP90 | +Inquiry |
H3N2993-216I | Native H3N2 (A/Shandong/9/93) H3N2993 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PSMA7-2776HCL | Recombinant Human PSMA7 293 Cell Lysate | +Inquiry |
TRHDE-800HCL | Recombinant Human TRHDE 293 Cell Lysate | +Inquiry |
SPATA20-1537HCL | Recombinant Human SPATA20 293 Cell Lysate | +Inquiry |
MIER3-4316HCL | Recombinant Human MIER3 293 Cell Lysate | +Inquiry |
LIPH-988HCL | Recombinant Human LIPH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ebpS Products
Required fields are marked with *
My Review for All ebpS Products
Required fields are marked with *
0
Inquiry Basket