Recombinant Full Length Staphylococcus Aureus Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL19655SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus Cardiolipin synthase(cls) Protein (P63801) (1-494aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-494) |
Form : | Lyophilized powder |
AA Sequence : | MIELLSIALKHSNIILNSIFIGAFILNLLFAFTIIFMERRSANSIWAWLLVLVFLPLFGF ILYLLLGRQIQRDQIFKIDKEDKKGLELIVDEQLAALKNENFSNSNYQIVKFKEMIQMLL YNNAAFLTTDNDLKIYTDGQEKFDDLIQDIRNATDYIHFQYYIIQNDELGRTILNELGKK AEQGVEVKILYDDMGSRGLRKKGLRPFRNKGGHAEAFFPSKLPLINLRMNNRNHRKIVVI DGQIGYVGGFNVGDEYLGKSKKFGYWRDTHLRIVGDAVNALQLRFILDWNSQATRDHISY DDRYFPDVNSGGTIGVQIASSGPDEEWEQIKYGYLKMISSAKKSIYIQSPYFIPDQAFLD SIKIAALGGVDVNIMIPNKPDHPFVFWATLKNAASLLDAGVKVFHYDNGFLHSKTLVIDD EIASVGTANMDHRSFTLNFEVNAFIYDQQIAKKLKQAFIDDLAVSSELTKARYAKRSLWI KFKEGISQLLSPIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; SA1891; Cardiolipin synthase; CL synthase |
UniProt ID | P63801 |
◆ Native Proteins | ||
TNFRSF11B-54H | Native Human Osteoprotegerin | +Inquiry |
CTSH-27404TH | Native Human CTSH | +Inquiry |
Lectin-1749G | Active Native Galanthus Nivalis Lectin Protein | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLVS2-7424HCL | Recombinant Human CLVS2 293 Cell Lysate | +Inquiry |
EPHB3-001HCL | Recombinant Human EPHB3 cell lysate | +Inquiry |
C11orf24-74HCL | Recombinant Human C11orf24 lysate | +Inquiry |
MMP15-4278HCL | Recombinant Human MMP15 293 Cell Lysate | +Inquiry |
GALNS-6040HCL | Recombinant Human GALNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket