Recombinant Full Length Listeria Welshimeri Serovar 6B Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL36550LF |
Product Overview : | Recombinant Full Length Listeria welshimeri serovar 6b Cardiolipin synthase(cls) Protein (A0ALI7) (1-482aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Listeria welshimeri serovar 6b |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-482) |
Form : | Lyophilized powder |
AA Sequence : | MGLLAYLLVVLLILNVFFAAVTVFLERRDTSATWAWLLVLTFVPIFGFIIYLIFGRKLSG KKIFDWKGQEKIGIQESTANQIEMIRQKEFPFSDSNVKKHRDLIYLLLVNDGAILTQDNE VELFIDGHEKFDALIADIEKAKDHIHLIYYIFHSDELGNRLMRVLERKAAEGLNVKIIYD AMGSRTTKKSFFRTFEKNGGLVRPFFPSKLPLINFRLNYRNHRKLAIIDGDISYIGGFNI GDEYLGLSKKFGYWRDTHLRVHGKAVYAMQTRFIMDWNSASSTNKIDYKPRYFPTFHGKG HTSMQIVSSGPDSEWQQIKNGYIKMINAAKKTIYLQSPYFIPDASLLEAIKIAALSGVDV RVMIPNKPDHAFVYRATTNYAGELMETGAKIFIYDNGFIHAKTLVVDGEIASVGTANMDF RSFRLNFEVNAFIYEKKMVQKLEDAFLEDILKSYQLTPELYAKRSLWIKFKEAVSRLLSP IL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; lwe2451; Cardiolipin synthase; CL synthase |
UniProt ID | A0ALI7 |
◆ Recombinant Proteins | ||
NI36-RS01205-0763S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS01205 protein, His-tagged | +Inquiry |
Mgmt-4062M | Recombinant Mouse Mgmt Protein, Myc/DDK-tagged | +Inquiry |
DCBLD2-2482C | Recombinant Chicken DCBLD2 | +Inquiry |
RFL3988MF | Recombinant Full Length Mouse Transmembrane Protein 129(Tmem129) Protein, His-Tagged | +Inquiry |
IL1F10-4727H | Recombinant Human IL1F10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
PLD-19S | Active Native Streptomyces sp. Phospholipase D, Type VII | +Inquiry |
L. biflexa-27 | Native Leptospira biflexa Antigen | +Inquiry |
FGB-31B | Native Bovine Fibrinogen | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL15-2222HCL | Recombinant Human RPL15 293 Cell Lysate | +Inquiry |
RNF182-2287HCL | Recombinant Human RNF182 293 Cell Lysate | +Inquiry |
PDCD1LG2-951CCL | Recombinant Cynomolgus PDCD1LG2 cell lysate | +Inquiry |
KCNK13-89HCL | Recombinant Human KCNK13 Lysate | +Inquiry |
RPA1-2243HCL | Recombinant Human RPA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket