Recombinant Full Length Geobacillus Kaustophilus Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL32450GF |
Product Overview : | Recombinant Full Length Geobacillus kaustophilus Cardiolipin synthase(cls) Protein (Q5L1S5) (1-502aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Geobacillus kaustophilus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-502) |
Form : | Lyophilized powder |
AA Sequence : | MRNTSRVAILVVIVGALLALTNGFWEGKLLGLFSVLMSCSVIFIALVISLENRKPAQTIA WLAVLGSFPIVGFLFYLLFGRNYWQQRRYKKKADFDEAVLLKFQEPSPIAVERLPMAPHQ RPLLRLAYRIGQHPVSLASQTAVLTNGEETFSSIFAELEKAEHHIHLEYYIVRHDEIGQQ LKRVLMEKARQGVRVRFLYDAVGSWKLSNAYIEELRAAGVEMIPFSPVRLPFLSNQINFR NHRKIIVIDGGVGFVGGLNIGDEYLGKNKYFGFWRDTHLLIRGEAVRTLQLIFLQDWYYM TGERLLTPDYLSPPLIVEEGQGGVQLIAGGPDQKWEVIKQLYFAMITSAKRSIWVASPYF VPDEDILTALKVAALSGIDVRLLAPKRPDKKIVFYASRSYFPELLEAGVKIYEYEKGFLH SKVIVVDGELASIGTANMDMRSFHLNFEVNAFLYYTDSIHKLVRDFLEDFRHASMIDYEQ FQQRPFRVRIAESVSRLLSPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; GK0820; Cardiolipin synthase; CL synthase |
UniProt ID | Q5L1S5 |
◆ Recombinant Proteins | ||
CEACAM5-194H | Recombinant Human CEACAM5 Protein, His\Avi-tagged | +Inquiry |
GALNT7-2469R | Recombinant Rat GALNT7 Protein | +Inquiry |
ABCA6-1082M | Recombinant Mouse ABCA6 Protein | +Inquiry |
RFL8151SF | Recombinant Full Length Synechocystis Sp. Cytochrome B6-F Complex Iron-Sulfur Subunit 2(Petc2) Protein, His-Tagged | +Inquiry |
CD5-235H | Recombinant Human CD5, StrepII-tagged | +Inquiry |
◆ Native Proteins | ||
PLAU-22H | Native Human PLAU protein | +Inquiry |
LDL-401H | Native Human Low Density Lipoprotein, Medium Oxidized, DiI labeled | +Inquiry |
SAA-95H | Native Human Serum amyloid A | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
C6-55H | Native Human Complement C6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPSR1-3728HCL | Recombinant Human NPSR1 293 Cell Lysate | +Inquiry |
TRIML1-760HCL | Recombinant Human TRIML1 293 Cell Lysate | +Inquiry |
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
CSH2-7246HCL | Recombinant Human CSH2 293 Cell Lysate | +Inquiry |
Raji-009HCL | Human Raji Whole Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket