Recombinant Full Length Bacillus Pseudofirmus Cardiolipin Synthase(Cls) Protein, His-Tagged
Cat.No. : | RFL16161BF |
Product Overview : | Recombinant Full Length Bacillus pseudofirmus Cardiolipin synthase(cls) Protein (O66043) (1-503aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bacillus pseudofirmus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-503) |
Form : | Lyophilized powder |
AA Sequence : | MKNRLNVLAFFALLFAALYISRGFLQSWMVGTLSVVFTLSVIFIGIIIFFENRHPTKTLT WLLVLAAFPVVGFFFYLMFGQNHRKSKRFSKKAIEDERAFQKIEGQRQLNEEQLKKMGGH QQLLFRLAHKLGKNPISFSSETKVLTDGKETYAHILQALKMAEHHIHLEYYIVRHDDLGN QIKDILISKAKEGVHVRFLYDGVGSWKLSKSYVEELRDAGVEMVSFSPVKLPFLTHTINY RNHRKIIVIDGVVGFVGGLNIGDEYLGKDAYFGYWRDTHLYVRGEAVRTLQLIFLQDWHY QTGETILNQTYLSPSLSMTKGDGGVQMIASGPDTRWEVNKKLFFSMITSAKKSIWIASPY FIPDDDILSALKIAALSGIDVRILVPNRPDKRIVFHASRSYFPELLEAGVKVYEYNRGFM HSKIIIVDHEIASIGTSNMDMRSFHLNFEVNAYLYRTSSVTKLVSDYVYDLEHSNQINFS LFKNRPFFHRLIESTSRLLSPLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cls |
Synonyms | cls; BpOF4_01900; Cardiolipin synthase; CL synthase |
UniProt ID | O66043 |
◆ Native Proteins | ||
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
Prothrombin-58M | Native Mouse Prothrombin | +Inquiry |
Prethrombin-2-304R | Native Rat Prethrombin-2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
B16-F10-2107HCL | B16-F10 (mouse skin melanoma) whole cell lysate | +Inquiry |
ZNF74-2083HCL | Recombinant Human ZNF74 cell lysate | +Inquiry |
TOMM22-871HCL | Recombinant Human TOMM22 293 Cell Lysate | +Inquiry |
Small Intestine-448H | Human Small Intestine Liver Cirrhosis Lysate | +Inquiry |
TBC1D24-1225HCL | Recombinant Human TBC1D24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All cls Products
Required fields are marked with *
My Review for All cls Products
Required fields are marked with *
0
Inquiry Basket