Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL6876SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q99R74) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SAV2563; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q99R74 |
◆ Recombinant Proteins | ||
EFCAB2-2656M | Recombinant Mouse EFCAB2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NIPAL2-6071M | Recombinant Mouse NIPAL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc25a20-1767R | Recombinant Rat Slc25a20 protein, His & T7-tagged | +Inquiry |
KDM6B-8599M | Recombinant Mouse KDM6B Protein | +Inquiry |
EPHA3-2697H | Active Recombinant Human EPHA3 protein, hFc&His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-352G | Native HAMSTER IgG | +Inquiry |
IgG-009H | Native Hamster Whole Molecule IgG, Biotin Conjugate | +Inquiry |
Ferritin-025B | Native Bovine Ferritin Protein, apo-form | +Inquiry |
RNASE1-392C | Native Cattle RNASE1 Protein | +Inquiry |
DPP4-31H | Active Native Human DPP4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BID-8455HCL | Recombinant Human BID 293 Cell Lysate | +Inquiry |
SNX13-1600HCL | Recombinant Human SNX13 293 Cell Lysate | +Inquiry |
BCL2L12-8487HCL | Recombinant Human BCL2L12 293 Cell Lysate | +Inquiry |
EML4-6608HCL | Recombinant Human EML4 293 Cell Lysate | +Inquiry |
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket