Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL14646SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q7A3E0) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKTKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SA2350; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q7A3E0 |
◆ Recombinant Proteins | ||
RPS4Y2-453H | Recombinant Human RPS4Y2 | +Inquiry |
CCDC134-2837M | Recombinant Mouse CCDC134 Protein | +Inquiry |
ARGLU1-417R | Recombinant Rat ARGLU1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cap-6432P | Recombinant Porcine circovirus 2 Cap protein(1-233aa), His-tagged | +Inquiry |
RHO-3355H | Recombinant Human RHO protein, His-SUMO-tagged | +Inquiry |
◆ Native Proteins | ||
CT-34 | Native Chlamydia trachomatis Antigen | +Inquiry |
ctxA-145V | Native Cholera Toxin A | +Inquiry |
PLG -62R | Native Rabbit plasmin | +Inquiry |
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC27A4-001HCL | Recombinant Human SLC27A4 cell lysate | +Inquiry |
JAM3-1074HCL | Recombinant Human JAM3 cell lysate | +Inquiry |
PNMA2-3080HCL | Recombinant Human PNMA2 293 Cell Lysate | +Inquiry |
GADD45G-6053HCL | Recombinant Human GADD45G 293 Cell Lysate | +Inquiry |
GAST-6014HCL | Recombinant Human GAST 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket