Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL11059SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q53590) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; NWMN_2463; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q53590 |
◆ Native Proteins | ||
LDH4-23H | Active Native Human Lactate Dehydrogenase 4 | +Inquiry |
PGI-241H | Native Human Pepsinogen I | +Inquiry |
FGF1-26203TH | Native Human FGF1 | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
H3N2-01I | Active Native IAV H3N2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CMA1-493HCL | Recombinant Human CMA1 cell lysate | +Inquiry |
DNAJC5B-498HCL | Recombinant Human DNAJC5B cell lysate | +Inquiry |
Kidney-798G | Guinea Pig Kidney Membrane Lysate, Total Protein | +Inquiry |
Stomach-486R | Rabbit Stomach Lysate | +Inquiry |
INSL6-5189HCL | Recombinant Human INSL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket