Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL8255SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q6G6B1) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SAS2449; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q6G6B1 |
◆ Recombinant Proteins | ||
SMYD2-6967H | Recombinant Human SMYD2, GST-tagged | +Inquiry |
BICDL1-5208H | Recombinant Human BICDL1 Protein, GST-tagged | +Inquiry |
RBL2-881H | Recombinant Human RBL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PLXNA1-1329HFL | Recombinant Full Length Human PLXNA1 Protein, C-Flag-tagged | +Inquiry |
S10AE-319H | Recombinant Human S10AE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Rectum-024H | Human Rectum Lysate, Total Protein | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
TI-50S | Active Native Soybean Trypsin Inhibitor | +Inquiry |
MUC19-185B | Native Bovine Mucin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-204H | Human Heart Cytoplasmic Lysate | +Inquiry |
GATA1-689HCL | Recombinant Human GATA1 cell lysate | +Inquiry |
DDIT4L-453HCL | Recombinant Human DDIT4L cell lysate | +Inquiry |
AMIGO1-8882HCL | Recombinant Human AMIGO1 293 Cell Lysate | +Inquiry |
NIM1K-1102HCL | Recombinant Human NIM1K cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket