Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL22635SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q2FV58) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETARVARSYGATVVDVVDDTDGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVETLINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMTAIVLWLFGSIASILGLCLSLK YRQMSVRKMVALYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SAOUHSC_02880; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q2FV58 |
◆ Recombinant Proteins | ||
PTK6-2801H | Recombinant Human PTK6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RACGAP1-10032Z | Recombinant Zebrafish RACGAP1 | +Inquiry |
PAGE4-262H | Recombinant Human PAGE4 Protein, GST/His-tagged | +Inquiry |
CEND1-1574M | Recombinant Mouse CEND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23154DF | Recombinant Full Length Drosophila Melanogaster Putative Gustatory Receptor 39A, Isoform D(Gr39A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IgG1-014M | Native Mouse IgG1 Isotype Control, R-Phycoerythrin Conjugated | +Inquiry |
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Collagen-59C | Native Chicken Collagen Type II | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGI2-4758HCL | Recombinant Human LGI2 293 Cell Lysate | +Inquiry |
GABRA3-6065HCL | Recombinant Human GABRA3 293 Cell Lysate | +Inquiry |
RBM39-2471HCL | Recombinant Human RBM39 293 Cell Lysate | +Inquiry |
FADS3-6471HCL | Recombinant Human FADS3 293 Cell Lysate | +Inquiry |
HIST1H2AM-5544HCL | Recombinant Human HIST1H2AM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket