Recombinant Full Length Staphylococcus Aureus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL4882SF |
Product Overview : | Recombinant Full Length Staphylococcus aureus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q6GDN6) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus aureus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MKWLSRILTVIVTMSMACGALIFNRRHQLKAKTLNFNHKALTIIIPARNEEKRIGHLLHS IIQQQVPVDVIVMNDGSTDETACVARSYGATVVDVVDDADGKWYGKSHACYQGVTHACTN RIAFVDADVTFLRKDAVEALINQYQLQGEKGLLSVQPYHITKRFYEGFSAIFNLMTVVGM NVFSTLDDGRTNQHAFGPVTLTNKEDYYATGGHKSANRHIIEGFALGSAYTSQSLPVTVY EGFPFVAFRMYQEGFQSLQEGWTKHLSTGAGGTKPKIMAAIVLWLFGSIASILGLCLSLK YRQMSVGKMLTVYLSYTTQFIYLHRRVGQFSNLLMVCHPLLFMFFTKIFIQSWKQTHRYG VVEWKGRQYSISKEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SAR2645; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q6GDN6 |
◆ Recombinant Proteins | ||
NGF-091H | Active Recombinant Human NGF Protein | +Inquiry |
FCGR3-4103C | Active Recombinant Rhesus FCGR3 protein, His/AVI-tagged | +Inquiry |
RFL27076HF | Recombinant Full Length Heterocapsa Niei Photosystem Q(B) Protein(Psba) Protein, His-Tagged | +Inquiry |
CPSF4-8640Z | Recombinant Zebrafish CPSF4 | +Inquiry |
DEAF1-4435M | Recombinant Mouse DEAF1 Protein | +Inquiry |
◆ Native Proteins | ||
Fixa-279B | Active Native Bovine Factor IXa - EGR | +Inquiry |
Stomach-004H | Human Stomach Lysate, Total Protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
Col1a1-7174M | Native Mouse Col1a1 Protein | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMPO-913HCL | Recombinant Human TMPO 293 Cell Lysate | +Inquiry |
Fetal Duodenum-139H | Human Fetal Duodenum Lysate | +Inquiry |
MARVELD2-4462HCL | Recombinant Human MARVELD2 293 Cell Lysate | +Inquiry |
CCDC51-7762HCL | Recombinant Human CCDC51 293 Cell Lysate | +Inquiry |
BROX-8152HCL | Recombinant Human C1orf58 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket