Recombinant Full Length Staphylococcus Haemolyticus 4,4'-Diaponeurosporenoate Glycosyltransferase(Crtq) Protein, His-Tagged
Cat.No. : | RFL15242SF |
Product Overview : | Recombinant Full Length Staphylococcus haemolyticus 4,4'-diaponeurosporenoate glycosyltransferase(crtQ) Protein (Q4L977) (1-375aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Staphylococcus Haemolyticus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-375) |
Form : | Lyophilized powder |
AA Sequence : | MTKLESLLHASTGLSLISGYLMYNRRYLLSFDKKREGETTQSISVIIPARNEEKRLPKLL KSLSQQSMRVECIVMDDDSNDRTAEIAREMGAKVYNVTYDNNGNTWIGKSYACYLGASYT VSDILIFMDADVELNNEHALEAIIQSYARQQYRGLMSIQPYHVVYKPYEHLSAMFNLMTV VGTNSFSTLSKSKGESLAFGPVTVMNKSDYILTQGHKNAASHIIEGFSLGKAFQRCQLPV TRFEGQGFVSFRMYEAGFKTMIEGWTKHLAVGASSTQPHIMMLIILWMVGCITSFSGLAL SLFMKTLSFKRMALSYSLYTLQFIRLHRRVGRFSILFLAINSILFLVFILVYINSYRHIH YTKQVKWKGRQFSIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | crtQ |
Synonyms | crtQ; SH0489; 4,4'-diaponeurosporenoate glycosyltransferase |
UniProt ID | Q4L977 |
◆ Recombinant Proteins | ||
SAP048A-027-2562S | Recombinant Staphylococcus aureus (strain: NE 3809) SAP048A_027 protein, His-tagged | +Inquiry |
SGTB-5029R | Recombinant Rat SGTB Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF4-2119R | Recombinant Rhesus Macaque IRF4 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCGR3A-626H | Active Recombinant Human FCGR3A Protein, His-tagged | +Inquiry |
YYBP-2214B | Recombinant Bacillus subtilis YYBP protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
MMP1-45H | Native Human MMP-1 | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
Endoproteinase Lys-C-85L | Native Lysobacter enzymogenes Endoproteinase Lys-C | +Inquiry |
Lectin-1843S | Active Native Solanum Tuberosum Lectin Protein, Fluorescein labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC6-297HCL | Recombinant Human CCDC6 cell lysate | +Inquiry |
ERRFI1-6542HCL | Recombinant Human ERRFI1 293 Cell Lysate | +Inquiry |
CD48-3044HCL | Recombinant Human CD48 cell lysate | +Inquiry |
ASTN2-141HCL | Recombinant Human ASTN2 cell lysate | +Inquiry |
WDR13-1923HCL | Recombinant Human WDR13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All crtQ Products
Required fields are marked with *
My Review for All crtQ Products
Required fields are marked with *
0
Inquiry Basket