Recombinant Full Length Solanum Lycopersicum 3-Hydroxy-3-Methylglutaryl-Coenzyme A Reductase 2(Hmg2) Protein, His-Tagged
Cat.No. : | RFL24797SF |
Product Overview : | Recombinant Full Length Solanum lycopersicum 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2(HMG2) Protein (P48022) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Solanum lycopersicum (Tomato) (Lycopersicon esculentum) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MDVRRRSEEPVYPSKVFAADEKPLKPHKKQQQQQEDKNTLLIDASDALPLPLYLTTNGLF FTMFFSVMYFLLSRWREKIRNSTPLHVVTLSELGAIVSLIASVIYLLGFFGIGFVQTFVS RGNNDSWDENDEEFLLKEDSRCGPATTLGCAVPAPPARQIAPMAPPQPSMSMVEKPAPLI TSASSGEDEEIIKSVVQGKIPSYSLESKLGDCKRAASIRKEVMQRITGKSLEGLPLEGFN YESILGQCCEMPIGYVQIPVGIAGPLLLNGKEFSVPMATTEGCLVASTNRGCKAIYASGG ATCILLRDGMTRAPCVRFGTAKRAAELKFFVEDPIKFESLANVFNQSSRFARLQRIQCAI AGKNLYMRLCCSTGDAMGMNMVSKGVQNVLDYLQNEYPDMDVIGISGNFCSDKKPAAVNW IEGRGKSVVCEAIITEEVVKKVLKTEVAALVELNMLKNLTGSAMAGALGGFNAHASNIVS AVFIATGQDPAQNIESSHCITMMEAVNDGKDLHISVTMPSIEVGTVGGGTQLASQSACLN LLGVKGANREAPGSNARLLATVVAGSVLAGELSLMSAISSGQLVNSHMKYNRSTKDVTKA SS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HMG2 |
Synonyms | HMG2; 3-hydroxy-3-methylglutaryl-coenzyme A reductase 2; HMG-CoA reductase 2 |
UniProt ID | P48022 |
◆ Recombinant Proteins | ||
KLF1-395H | Recombinant Human KLF1 protein, His-B2M-tagged | +Inquiry |
GM806-3732M | Recombinant Mouse GM806 Protein, His (Fc)-Avi-tagged | +Inquiry |
ILF2-12438Z | Recombinant Zebrafish ILF2 | +Inquiry |
USF1-1203H | Active Recombinant Human Upstream Transcription Factor 1, GST-tagged | +Inquiry |
PLCB4-4161R | Recombinant Rat PLCB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
BLA-01B | Native Bovine β-Lactoglobulin Protein | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
AMY2B-1858H | Native Human Amylase, Alpha 2B (pancreatic) | +Inquiry |
◆ Cell & Tissue Lysates | ||
TDGF1-832RCL | Recombinant Rat TDGF1 cell lysate | +Inquiry |
CYP7A1-7099HCL | Recombinant Human CYP7A1 293 Cell Lysate | +Inquiry |
Spleen-466H | Human Spleen Liver Cirrhosis Lysate | +Inquiry |
BRK1-8055HCL | Recombinant Human C3orf10 293 Cell Lysate | +Inquiry |
CDC7-7646HCL | Recombinant Human CDC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMG2 Products
Required fields are marked with *
My Review for All HMG2 Products
Required fields are marked with *
0
Inquiry Basket