Recombinant Full Length Simian Virus 5 Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL16647PF |
Product Overview : | Recombinant Full Length Simian virus 5 Hemagglutinin-neuraminidase(HN) Protein (P28884) (1-565aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Parainfluenza virus 5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-565) |
Form : | Lyophilized powder |
AA Sequence : | MVAEDAPVRGTCRVLFRTTTLIFLCTLLALSISILYESLIIRKQIMSQAGSTGSNFRLGS ITDLLNNILSVANQIIYNSAVALPLQLDTLESTLLTAIKSLQTSDKLEQNCSWGAALIND NRYINGINQFYFSIAEGRNLTLGPLLNIPSFIPTATTPEGCTRIPSFSLTKTHWCYTHNV ILNGCQDHVSSNQFVSMGIIEPTSAGFPSFRTLKTLYLSDGVNRKSCSISTVPGGCMMYC FVSTQPERDDYLSTAPPEQRIIIMYYNDTIVERIINPPGVLDVWATLNPGTGSGVYYLGW VLFPTYGGVIKDTSLWNNQANKYFIPQMVAALCSQNQATQVQNAKSSYYSSWFGNRMIQS GILACPLQQDLTNECLILPFSNDQVLMGAEGRLYMYGDSVYYYQRSNSWWPMTMLYKVTI TFTNGQPSAISAQNVPTQQVPRPGTGDCSATNRCPGFCLKGVYADAWLLTNPSSTSTFGS EATFTGSYLNAATQRINPTMYIANNTQIISSQQFGSSGQEAAYGHTTCFRDTGSVMVYCI YIIELSSSLLGQFQIVPFIRQVTLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P28884 |
◆ Recombinant Proteins | ||
ACTR6-240H | Recombinant Human ACTR6 Protein, GST-tagged | +Inquiry |
FOXS1-5399H | Recombinant Human FOXS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDE4DIP-2566H | Recombinant Human PDE4DIP Protein, His-tagged | +Inquiry |
Spike-4885V | Active Recombinant COVID-19 Spike S1 protein (HV69-70del), His-tagged | +Inquiry |
RFL35517MF | Recombinant Full Length Mouse Fatty Acid Desaturase 1(Fads1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
HBA2-27786TH | Native Human HBA2 | +Inquiry |
Plg-5465R | Native Rat Plasminogen | +Inquiry |
PSMA3-419S | Active Native S. aureus PSM-alpha 3 protein | +Inquiry |
CRP-8057H | Native C-Reactive Protein | +Inquiry |
VCL-899T | Native Turkey VCL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
GFRA4-5951HCL | Recombinant Human GFRA4 Cell Lysate, transcript variant 1 | +Inquiry |
KRCC1-4884HCL | Recombinant Human KRCC1 293 Cell Lysate | +Inquiry |
ERP27-1501HCL | Recombinant Human ERP27 cell lysate | +Inquiry |
PCDHA4-1296HCL | Recombinant Human PCDHA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket