Recombinant Full Length Sendai Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL24934SF |
Product Overview : | Recombinant Full Length Sendai virus Hemagglutinin-neuraminidase(HN) Protein (P19758) (1-575aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sendai virus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-575) |
Form : | Lyophilized powder |
AA Sequence : | MDGDRGKRDSYWSTSPSGSTTKLASGWERSSKVDTWLLILSFTQWALSIATVIICIIISA RQGYSMKEYSMTVEALNMSSREVKESLTSLIRQEVIARAVNIQSSVQTGIPVLLNKNSRD VIQMIDKSCSRQELTQLCESTIAVHHAEGIAPLEPHSFWRCPVGEPYLSSDPKISLLPGP SLLSGSTTISGCVRLPSLSIGEAIYAYSSNLITQGCADIGKSYQVLQLGYISLNSDMFPD LNPVVSHTYDINDNRKSCSVVATGTRGYQLCSMPTVDERTDYSSDGIEDLVLDVLDLKGS TKSHRYRNSEVDLDHPFSALYPSVGNGIATEGSLIFLGYGGLTTPLQGDTKCRTQGCQQV SQDTCNEALKITWLGGKQVVSVIIQVNDYLSERPKIRVTTIPITQNYLGAEGRLLKLGDR VYIYTRSSGWHSQLQIGVLDVSHPLTINWTPHEALSRPGNEECNWYNTCPKECISGVYTD AYPLSPDAANVATVTLYANTSRVNPTIMYSNTTNIINMLRIKDVQLEAAYTTTSCITHFG KGYCFHIIEINQKSLNTLQPMLFKTSIPKLCKAES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase; HN protein |
UniProt ID | P19758 |
◆ Recombinant Proteins | ||
GCDHB-1540Z | Recombinant Zebrafish GCDHB | +Inquiry |
CHRNB2-0003H | Recombinant Human CHRNB2 protein, His-V5-tagged | +Inquiry |
MUP3-10253M | Recombinant Mouse MUP3 Protein | +Inquiry |
BRD4-5928H | Recombinant Human BRD4 protein, His-tagged | +Inquiry |
KLRB1-3295R | Recombinant Rat KLRB1 Protein | +Inquiry |
◆ Native Proteins | ||
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
CFH-23H | Active Native Human Complement factor H | +Inquiry |
Hld-730S | Active Native S. aureus delta Hemolysin Protein | +Inquiry |
HPIV3ag-275V | Active Native Parainfluenza Virus type 3(strain III v 2932) Protein | +Inquiry |
LDLc-01H | Native Human Low-Density Lipoprotein cholesterol | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLD4-3051HCL | Recombinant Human POLD4 293 Cell Lysate | +Inquiry |
Stomach-776C | Chicken Stomach Membrane Lysate, Total Protein | +Inquiry |
TFAP4-1137HCL | Recombinant Human TFAP4 293 Cell Lysate | +Inquiry |
PSMC5-2759HCL | Recombinant Human PSMC5 293 Cell Lysate | +Inquiry |
NFYA-3840HCL | Recombinant Human NFYA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket