Recombinant Full Length Shigella Sonnei Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL3733SF |
Product Overview : | Recombinant Full Length Shigella sonnei Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q3Z3Q4) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shigella sonnei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTPLLELKDIRRSYPAGNEQVEVLKGISLDIYAGEMVAIVGASGSGKSTLMNILGCLDKA TSGTYRVAGQDVATLDADALAQLRREHFGFIFQRYHLLSHLTAEQNVEVPAVYAGLERKQ RLLRAQELLQRLGLEDRTEYYPAQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILHQLRDRGHTVIIVTHDPQVAAQAERVIEIRDGEIVRNPPAIEKVNVAGGTEPV VNTVSGWRQFVSGFNEALTMAWRALAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRSIGTNTIDVYPGKDFGDDDPQYQQALKYDDLIAIQKQPWVASATPAVSQNLRLRY NNVDVAASANGVSGDYFNVYGMTFSEGNTFNQEQLNGRAQVVVLDSNTRRQLFPHKADVV GEVILVGNMPARVIGVAEEKQSMFGSSKVLRVWLPYSTMSGRVMGQSWLNSITVRVKEGF DSAEAEQQLTRLLSLRHGKKDFFTWNMDGVLKTVEKTTRTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGITLSLLIAFTLQL FLPGWEIGFSPLALLLAFLCSTATGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; SSON_0866; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q3Z3Q4 |
◆ Recombinant Proteins | ||
ATP5H-985H | Recombinant Human ATP5H protein, GST-tagged | +Inquiry |
GUCY2D-1519H | Recombinant Human GUCY2D protein, His-Avi-tagged, Biotinylated | +Inquiry |
SCO4426-422S | Recombinant Streptomyces coelicolor A3(2) SCO4426 protein, His-tagged | +Inquiry |
GALNT11-001H | Active Recombinant Human GALNT11 Protein, His-tagged | +Inquiry |
DPP3-4116HF | Recombinant Full Length Human DPP3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Lectin-1772E | Active Native Erythrina Cristagalli Lectin Protein, Agarose bound | +Inquiry |
PRTN3-242H | Native Human Proteinase 3 | +Inquiry |
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
RV-11 | Native Rubella Virus Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR2-001RCL | Recombinant Rat TLR2 cell lysate | +Inquiry |
Thyroid-71H | Human Thyroid Tissue Lysate | +Inquiry |
RAB11FIP2-2629HCL | Recombinant Human RAB11FIP2 293 Cell Lysate | +Inquiry |
HSD17B8-5371HCL | Recombinant Human HSD17B8 293 Cell Lysate | +Inquiry |
Brain-764C | Chicken Brain Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket