Recombinant Full Length Bartonella Henselae Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL35754BF |
Product Overview : | Recombinant Full Length Bartonella henselae Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q6G1V5) (1-660aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bartonella Henselae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-660) |
Form : | Lyophilized powder |
AA Sequence : | MKAKQADAVLVLENIVRKFPAGETFVTVLKDINLTIKRGEMVAIVGASGSGKSTLMNILG CLDRPTFGRYWISGKETASLSADELSALRRNHFGFIFQRYHLLNELTALGNVEIPAVYAG YAPEVRRKRAEDLLTRLGMRDRIHHRPNQLSGGQQQRVSIARALMNNAEVILADEPTGAL DKKSGQEVLRILDELHQEGRTIIMVTHDMQVAERADRIIEISDGEIIADNVSKVAKTKTD SQALYGKQVLKDQKTLGFFRSFAERFREAFVMALLAMNAHRMRTFLTMLGVIIGIGAIIA MVALGNGTREKILENFKSLGSNTLTILPGKSLSDPQAEKITSLVEADAEALSKLPYVSGV TPQMSASSTIRFGSVEADVVIAGVGEQYFQTQGLNAVQGRLFDQKSVHDRAIDLVIEKEA LAVLFPHSHESPLGKVVHVGNVPVRIVGVIDPQHNGGTSSTLQVYLPYTTVQTRFLGTTQ VRAITVKIADTVDSNLAETMVRRFLIMRHGEEDFFIRNSQLFRDRIMESTHILTLLVSSI AAISLIVGGIGVMNIMLVTVSERINEIGVRMAVGARQSDILQQFLIEAILVCVIGGGLGI LFGMSIGGLFLLFKAPIHLIYTIDSIILSLTFSTLIGVCFGFSPARQASRLDPVVALSRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; BH15460; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q6G1V5 |
◆ Recombinant Proteins | ||
FAM188A-1594R | Recombinant Rhesus monkey FAM188A Protein, His-tagged | +Inquiry |
DPCD-4781C | Recombinant Chicken DPCD | +Inquiry |
MT1H-127H | Recombinant Human MT1H, GST-tagged | +Inquiry |
GANAB-280C | Recombinant Cynomolgus Monkey GANAB Protein, His (Fc)-Avi-tagged | +Inquiry |
CNPY4-946R | Recombinant Rhesus monkey CNPY4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-353C | Native Chicken IgG | +Inquiry |
TSH-10B | Active Native Bovine TSH Protein | +Inquiry |
LDL-247H | Native Human Lipoproteins, Very Low Density | +Inquiry |
LDH-35C | Active Native Chicken Lactate dehydrogenase | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP18-469HCL | Recombinant Human USP18 293 Cell Lysate | +Inquiry |
OXGR1-3506HCL | Recombinant Human OXGR1 293 Cell Lysate | +Inquiry |
CENPV-7574HCL | Recombinant Human CENPV 293 Cell Lysate | +Inquiry |
RAB31-2608HCL | Recombinant Human RAB31 293 Cell Lysate | +Inquiry |
YWHAQ-230HCL | Recombinant Human YWHAQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket