Recombinant Full Length Bradyrhizobium Japonicum Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL18496BF |
Product Overview : | Recombinant Full Length Bradyrhizobium japonicum Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q89NX6) (1-653aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bradyrhizobium diazoefficiens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-653) |
Form : | Lyophilized powder |
AA Sequence : | MTEPILALSHICREFMTGDTKVAALADVTLDIDRGELVAIIGSSGSGKSTLLNILGCLDH ATSGSYRVAGEDVAALDADALAALRREHFGFIFQRYHLLSELPALENVEIPAVYAGDTAS ERQARAERLLARLGMAERRGHRPNQLSGGQQQRVSIARALMNGAEVVLADEPTGALDRRS GEEVLKILVELHREGKTIIIVTHDPEVAKRANRVIELRDGLVVSDKRTDAAVATAAASLP ADKPDTRSSRWSGLAFRFRETLRMALLSMAAHRLRSFLTMLGIIIGIAAVSSVVALGNAS QNKVLSDISNLGTNTIEVFPGKDFGDARAGKIKTLVLDDARALDRQTFIAGVTPTVSTST TVRYRDRESNVLVNGVDRSYFQVKGTKIAAGALFDAVAVRNIERQAVIDDNTRRTFFSDD QNAGIGRVIWVGKVPCRVVGVIAQQQGGFGSNQNLSVYLPYTTVQAQFTGDRSLRSVLLR VSDEVSTDLAQEAVTTLLTRRHSTKDFVILNTDDIRRTITSTTQTLAFLVAAIAVISLVV GGIGVMNIMLVSVSERIGEIGVRMAVGARREDILQQFLVEATLISSLGGIAGILIAVALG ALLNLLLPGFQVSYSTFSIGAAFLTSTAIGIFFGYFPARRAASFDPVVALSRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; bll3707; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q89NX6 |
◆ Recombinant Proteins | ||
NPY1R-3179C | Recombinant Chicken NPY1R | +Inquiry |
P2RY10-3088R | Recombinant Rhesus Macaque P2RY10 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAU-1296H | Recombinant Human Plasminogen Activator, Urokinase | +Inquiry |
DNM1L-8493H | Active Recombinant Human DNM1L Protein, Myc/DDK-tagged | +Inquiry |
HO-1-301242H | Recombinant Human HO-1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
F12-5397H | Active Native Human Coagulation Factor XII (Hageman factor) | +Inquiry |
ALB-4783D | Native Dog Albumin | +Inquiry |
FG-163B | Native Bovine fibrinogen | +Inquiry |
CHOD-22 | Active Native Cholesterol esterase | +Inquiry |
F2-5401B | Native Bovine Coagulation Factor II (thrombin) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAL-5641HCL | Recombinant Human HAL 293 Cell Lysate | +Inquiry |
TRAFD1-815HCL | Recombinant Human TRAFD1 293 Cell Lysate | +Inquiry |
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
SCP2-2023HCL | Recombinant Human SCP2 293 Cell Lysate | +Inquiry |
CCNYL1-7699HCL | Recombinant Human CCNYL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket