Recombinant Full Length Psychrobacter Cryohalolentis Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL10054PF |
Product Overview : | Recombinant Full Length Psychrobacter cryohalolentis Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q1QDA8) (1-665aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psychrobacter cryohalolentis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-665) |
Form : | Lyophilized powder |
AA Sequence : | MSSQDLYANAATDKPLMQVKGLIREFKAGEQTIRVLHDINLTIHQGEMVAIIGQSGSGKS TLMNILGCLDQATAGDYQVFGQSVNRLVPDELAKLRREHFGFIFQRYHLLGDISARDNVS VPAVYAGMDGQARNERAEKLLSDLGLADKVNNRPSQLSGGQQQRVSIARALMNGGDIILA DEPTGALDSKSGKDVVQILKDLNAQGHTIIMVTHDPSLAAQAERVIEIKDGYIIADYKNE DYQRPAAQPASIIDKHRKSAFGSFIDRLLESFKMSLLAMRAHKMRTLLTMLGIIIGIASV VSVVGLGKGSQEQILSNISSLGTNTITVTDGYPYGDPRRQYNDDNLTPQDAQAVADQPYV LSVSPQLNSNMSVRYRNVQEAASISGVGKDYLDVSGETLAMGQGFDEQSILRRTQDIIID SNAHKTFFPTIANPIGEVLLIGSVPGRVIGVLEPNEGGFSRSVDTPTLYMPYTTMMSRLI GSAYIESFIALIDNNISSSAAESAISDLMTSRHGTDDFRIRNSDSIRQTIESTTAALTLL ISSIAIISLIVGGIGVMNIMLVSVTERTNEIGVRMAVGARQSDIMQQFLIEAILVCILGG LLGIGLAFAIGELINRVGGDSFKVIYSSTSIIAAFVCSTLIGVVFGFLPARNAAKLDPVE ALSRD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; Pcryo_0562; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q1QDA8 |
◆ Recombinant Proteins | ||
RFL35283AF | Recombinant Full Length Arabidopsis Thaliana Aquaporin Tip4-1(Tip4-1) Protein, His-Tagged | +Inquiry |
RPSR-1607B | Recombinant Bacillus subtilis RPSR protein, His-tagged | +Inquiry |
Cd47-647M | Recombinant Mouse Cd47 protein, His-tagged | +Inquiry |
PRMT7-7127M | Recombinant Mouse PRMT7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDND2-6188HF | Recombinant Full Length Human CLDND2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1811N | Active Native Narcissus Pseudonarcissus Lectin Protein, Biotinylated | +Inquiry |
Lectin-1811M | Active Native Maclura Pomifera Lectin Protein, Fluorescein labeled | +Inquiry |
Tyrosinase-39 | Native Tyrosinase, Enzyme Activity | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF1R-823RCL | Recombinant Rat CSF1R cell lysate | +Inquiry |
NCF1-3950HCL | Recombinant Human NCF1 293 Cell Lysate | +Inquiry |
NPAS2-1208HCL | Recombinant Human NPAS2 cell lysate | +Inquiry |
S100B-2858HCL | Recombinant Human S100B cell lysate | +Inquiry |
PHLDA3-3219HCL | Recombinant Human PHLDA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket