Recombinant Full Length Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL18883SF |
Product Overview : | Recombinant Full Length Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q8Z824) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTALLELCNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK RQARARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAQEKKREQGVDAAV VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQPWVNSATPSVSKSLRLRY GNIDIAVNANGVSGDYFNVYGMSFREGNTFNAVQQQDRAQVVVLDANTRRQLFPNKANVV GEVVLVGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; STY0938; t1991; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q8Z824 |
◆ Recombinant Proteins | ||
FSCN1-6054M | Recombinant Mouse FSCN1 Protein | +Inquiry |
CCND1-2608C | Recombinant Cattle CCND1 protein, His & T7-tagged | +Inquiry |
ENOX2-2850H | Recombinant Human ENOX2 protein | +Inquiry |
RFL27940AF | Recombinant Full Length Albinaria Coerulea Atp Synthase Subunit A(Atp6) Protein, His-Tagged | +Inquiry |
SMAD5-162H | Recombinant Human SMAD5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
GH1-8147H | Native Growth Hormone (GH) | +Inquiry |
GSN-874P | Active Native Porcine GSN Protein | +Inquiry |
TG-22P | Native Porcine Thyroglobulin (TG) Protein | +Inquiry |
ACOD-35 | Active Native acyl-CoA oxidase | +Inquiry |
A2M-01H | Native Human A2M Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASTK-6322HCL | Recombinant Human FASTK 293 Cell Lysate | +Inquiry |
CLEC10A-1456HCL | Recombinant Human CLEC10A cell lysate | +Inquiry |
MT3-4095HCL | Recombinant Human MT3 293 Cell Lysate | +Inquiry |
ASB13-8666HCL | Recombinant Human ASB13 293 Cell Lysate | +Inquiry |
CCNA2-7718HCL | Recombinant Human CCNA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket