Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL16428BF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7VR44) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Blochmannia floridanus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MHYCNNGNISNWKVFRRLWPIINPFKIGLIIASITLIINAVSDSLMLALLKPLLDEGFGK ANRSIFMWMPLVLMGLMIMRGMSGFASTYCISWVSGKVVMHIRRLLFNHIMNMPVSFFIE QSTATLMSRITYDADQVASSSSGALITIIREGASVVGLCIMMFYYSWQLSLVLILIMPII SIIIKLVSNKFKDIGKKIQNSMSQLVNSVEQMLKGHKEVLIFGGQHLEQNRFNYLSNRMR QYTMKMVQTSSVFEPLIQFVASLALACVLYIASIPSVIEMLSAGTITVIFSSMIALMKPL KSLTNVSAQFQRGMVACQTLFTILDLKTEKNIGKFSVKRVKGHIIFDNVTFFYPETNTPS LCNINFNIESGKTIALVGRSGSGKSTIVNLLTRFYDVYQGRILLDGLNLNDYTLTSLREQ VSVVTQNVYLFNDTIANNIAYARTRFYSRASIEEAAKMAYAMGFISKMKNGFDTIVGENG ILLSNGQRQRIAIARALLRNCPILILDEATSSLDTESECIIYKSINILKKNRTSLIIAHR LSTIENADEILVVERGSIVERGIHVDLLNHKGVYSQLYKFQFS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Bfl379; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7VR44 |
◆ Recombinant Proteins | ||
PPP3CC-5693H | Recombinant Human PPP3CC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL11332BF | Recombinant Full Length Bovine Inward Rectifier Potassium Channel 2(Kcnj2) Protein, His-Tagged | +Inquiry |
DSG1-1994H | Recombinant Human DSG1 Protein (Glu50-Pro548), N-His tagged | +Inquiry |
RPS29-12202Z | Recombinant Zebrafish RPS29 | +Inquiry |
ATPAF1-1020H | Recombinant Human ATPAF1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
CNTF-26839TH | Native Human CNTF | +Inquiry |
CGB-29186TH | Native Human CGB | +Inquiry |
APOE-5283H | Native Human Apolipoprotein E | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATF3-8631HCL | Recombinant Human ATF3 293 Cell Lysate | +Inquiry |
PSMD13-2752HCL | Recombinant Human PSMD13 293 Cell Lysate | +Inquiry |
NR0B1-3723HCL | Recombinant Human NR0B1 293 Cell Lysate | +Inquiry |
TRMT1L-224HCL | Recombinant Human TRMT1L cell lysate | +Inquiry |
SIRT5-1830HCL | Recombinant Human SIRT5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket