Recombinant Full Length Coxiella Burnetii Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL31723CF |
Product Overview : | Recombinant Full Length Coxiella burnetii Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q83D84) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Coxiella Burnetii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MKTLTSQGIRTYGRLLQATKQYWPIFLIGVVGMIAVSLSDAGFTWLIKPIINRGFIARDL VFIRWLPFIIVLVFLFRGAANFLSTYFINRVARNIVMDFRRAIFSHLLRLPAEFYDRHSS GHLLSTVIYNVEQVAQASSDALIITLQASSLVVGLLVVMFLVSWKLTLFFLVITPLIAWV MRVCSARLRHLSTSVQKSVGEVTHIASEAIEAYKIVRLYGGQKYENEKFRHATKLNQQRE LKVVVTNSVGTSLVQLLIAIPIAIVLFFATQPSFHVTAGSFASIVSAMIMMLRPVRRLTM VNSYIQKGIAAAESIFKLLDEDVEKDRGERHLVRARGAIEYQGVSFAYDNSKKTILSEIS FSIEPGQMVAIVGRSGAGKSTLINLLPRFYDASTGVIKIDDINIKEFRLQELRNQFGLVS QHTTLFNDTILNNIAYGQAGSIDKRKIIEAARAAHAMEFIEQLPEGLDTVIGENGVRLSG GQRQRIAIARALFKNAPIHILDEATSSLDTHSERHIQAALDNLMDQCTTLVIAHRLSTIE RADWIMVLEEGRLIEKGTHQQLLTLNGAYAELYRMQFAEKPAAMTALDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; CBU_0856; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q83D84 |
◆ Recombinant Proteins | ||
NM-01C | Recombinant CoV-2 N-Mosaic Protein, His-tagged | +Inquiry |
ACLY-916H | Recombinant Human ACLY Protein, MYC/DDK-tagged | +Inquiry |
RFL15835IF | Recombinant Full Length Influenza A Virus Neuraminidase(Na) Protein, His-Tagged | +Inquiry |
FOXP2-4473H | Recombinant Human FOXP2 Protein, GST-tagged | +Inquiry |
ING2-2064H | Recombinant Human ING2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
C5-53H | Native Human Complement C5 | +Inquiry |
SERPINA7-8269H | Native Human Serum Thyroxine Binding Globulin | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
B. afzelii-21 | Native Borrelia afzelii Antigen | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCE3E-4805HCL | Recombinant Human LCE3E 293 Cell Lysate | +Inquiry |
PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
ZNF394-81HCL | Recombinant Human ZNF394 293 Cell Lysate | +Inquiry |
C10orf2-8371HCL | Recombinant Human C10orf2 293 Cell Lysate | +Inquiry |
SK-N-SH-01HL | Human SK-N-SH lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket