Recombinant Full Length Shewanella Oneidensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL25401SF |
Product Overview : | Recombinant Full Length Shewanella oneidensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8EDF0) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Shewanella oneidensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MTASPKNEMWTVFKRLMGYLKPMKGMFLLSVVGLIVYGLVDAAFISFIGPFIDKGFSSSA PAISNGIALPTSQGFHADNQVLLMAPIVVILMFSLRGFANFVSTYGISYMSARLIMDMRQ QVFEHYLSLPVSYMDKENTGNLISKVTFDTEQIARASGSALISIVRDSVTIIGMLGLMFY NSWKLSLCILVIGPIMGVVITIVSRRFRKVSKQIQTAMGDVSAATEQMIKGHKNVLAFGG QETETARFAKINDRNRHQNMKLAVAQAVSQPLIMVIGSFALAFVLYAASLDSMKADLTAG TFATILGAMMAMLQPIKNLTRVNAEFQRGIAACTTVFELLDTVPESDTGTYTVARAKGNL RFDNVSFSYEGQERRALEKIDFEVSQGQTLALVGRSGSGKSTIASLVTRFYTGLESGDIL LDDVSIYDYSLKSLRSQVALVSQQVTLFNDTIANNIAYAYPGEVTREQIIEAATLAHAME FIEQLPDGLDTQVGENGVLLSGGQRQRIAIARAMLRDAPVLILDEATSALDTESEKAIQQ GLDNLRQNRTSVVIAHRLSTIESADQILVVDQGRIVERGTHKSLLELGGMYAKLYQMQFG S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SO_2802; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8EDF0 |
◆ Recombinant Proteins | ||
RFL20611BF | Recombinant Full Length Bovine Tumor Necrosis Factor(Tnf) Protein, His-Tagged | +Inquiry |
OSR2-4046C | Recombinant Chicken OSR2 | +Inquiry |
RFL1105EF | Recombinant Full Length Escherichia Fergusonii Upf0299 Membrane Protein Yohj(Yohj) Protein, His-Tagged | +Inquiry |
SMC5-8471M | Recombinant Mouse SMC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRKACG-30211TH | Recombinant Human PRKACG | +Inquiry |
◆ Native Proteins | ||
Myh2-13R | Active Native Rabbit Myosin II Protein | +Inquiry |
Batroxobin-99 | Native Bothrops atrox snake venom Batroxobin Protein | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
LL-2-991M | LL/2 (mouse Lewis lung carcinoma) whole cell lysate | +Inquiry |
LIPH-988HCL | Recombinant Human LIPH cell lysate | +Inquiry |
Embryonic Fibroblast-070MCL | Mouse Embryonic Fibroblast Whole Cell Lysate | +Inquiry |
STX3-1376HCL | Recombinant Human STX3 293 Cell Lysate | +Inquiry |
Rectum-469C | Cat Rectum Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket