Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL15515YF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q66CI3) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia Pseudotuberculosis Serotype I |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MMNDKDLSTWQTFRRLWPTISPYKAGLIVAAIALILNAASDTFMLSLLKPLLDDGFGNSN SSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQS TGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSI SIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQ GMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAGTITVVFSAMIALMRPLKS LTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPGKDTPALN DINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVA LVSQNVHLFNDTVANNIAYARNEQYSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIM LSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; YPTB1420; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q66CI3 |
◆ Recombinant Proteins | ||
RFL28545CF | Recombinant Full Length Dna Translocase Ftsk(Ftsk) Protein, His-Tagged | +Inquiry |
LUC7L3-3174C | Recombinant Chicken LUC7L3 | +Inquiry |
RFL34658CF | Recombinant Full Length Probable Calcium-Binding Mitochondrial Carrier F17E5.2(F17E5.2) Protein, His-Tagged | +Inquiry |
PIGF-1123H | Active Recombinant Human PIGF Protein, Fc-tagged | +Inquiry |
GARS-4731H | Recombinant Human GARS Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
Immunoglobulin A-76H | Native Human Immunoglobulin A | +Inquiry |
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
BPI-72H | Native Human Bacterial/Permeability-Increasing Protein | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN1-6696HCL | Recombinant Human EGLN1 293 Cell Lysate | +Inquiry |
ESD-6541HCL | Recombinant Human ESD 293 Cell Lysate | +Inquiry |
HIST1H4I-5521HCL | Recombinant Human HIST1H4I 293 Cell Lysate | +Inquiry |
C6orf25-7983HCL | Recombinant Human C6orf25 293 Cell Lysate | +Inquiry |
THOC7-1091HCL | Recombinant Human THOC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket