Recombinant Full Length Salmonella Paratyphi A Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL18635SF |
Product Overview : | Recombinant Full Length Salmonella paratyphi A Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5PGH0) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella paratyphi A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLMIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; SPA1814; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5PGH0 |
◆ Recombinant Proteins | ||
HAVCR2-213CF | Recombinant Monkey HAVCR2 Protein, Fc-tagged, FITC conjugated | +Inquiry |
DERP2-1089D | Recombinant Dermatophagoides pteronyssinus DERP2 Protein (Full Length), N-His tagged | +Inquiry |
MRPL44-3340Z | Recombinant Zebrafish MRPL44 | +Inquiry |
ARGS-3870S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 ARGS protein, His-tagged | +Inquiry |
SLGD-RS00455-5265S | Recombinant Staphylococcus lugdunensis HKU09-01 SLGD_RS00455 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CA2-30H | Native Human Carbonic Anhydrase II (CA2) Protein | +Inquiry |
Collagen Type I & III-08R | Native Rat Collagen Type I and III Protein | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
S-52H | Native Human Protein S | +Inquiry |
Staphylococcus aureus-01 | Native S. aureus Suspension (Wood 46 strain) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NMRK1-7918HCL | Recombinant Human C9orf95 293 Cell Lysate | +Inquiry |
CLIC5-7445HCL | Recombinant Human CLIC5 293 Cell Lysate | +Inquiry |
CENPH-7584HCL | Recombinant Human CENPH 293 Cell Lysate | +Inquiry |
PSEN1-2790HCL | Recombinant Human PSEN1 293 Cell Lysate | +Inquiry |
ST3GAL2-1702HCL | Recombinant Human ST3GAL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket