Recombinant Full Length Haemophilus Influenzae Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL24938HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (P44407) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIVSGVALVFNALADSGLIYLLKPLLDDGF GKANHSFLKMMAFVVVGMIILRGITNFISNYCLAWVSGKVVMTMRRRLFKHLMFMPVSFF DQNSTGRLLSRITYDSQMIASSSSGSLITIVREGAYIISLFAVMFYTSWELTIVLFIIGP IIAVLIRLVSKIFRRLSKNLQDSMGELTSATEQMLKGHKVVLSFGGQHVEEVHFNHVSND MRRKSMKMVTANSISDPVVQVIASLALATVLYLATTPLIAEDNLSAGSFTVVFSSMLAMM RPLKSLTAVNAQFQSGMAACQTLFAILDLEPEKDDGAYKAEPAKGELEFKNVSFAYQGKD ELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNL RENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAAAKAAYALEFIEKLPQVFDTVIG ENGTSLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALEELKKDRTVVVI AHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFTG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; msh-1; HI_0060; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | P44407 |
◆ Recombinant Proteins | ||
Cdhr2-2082M | Recombinant Mouse Cdhr2 Protein, Myc/DDK-tagged | +Inquiry |
RFL20801SF | Recombinant Full Length Saccharomyces Cerevisiae Pheromone Alpha Factor Receptor(Ste2) Protein, His-Tagged | +Inquiry |
RAD54L-1853H | Recombinant Human RAD54L Protein, His (Fc)-Avi-tagged | +Inquiry |
CD7-832H | Recombinant Human CD7 Protein, His-tagged | +Inquiry |
YDBB-3329B | Recombinant Bacillus subtilis YDBB protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Papain-149 | Active Native Immobilized Papain | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
GFAP-171B | Native bovine GFAP | +Inquiry |
TGase-12S | Active Native Streptoverticillium mobaraense Transglutaminase Protein (Food Grade) | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCEAL6-1750HCL | Recombinant Human TCEAL6 cell lysate | +Inquiry |
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
PROK1-001HCL | Recombinant Human PROK1 cell lysate | +Inquiry |
ZNF57-2056HCL | Recombinant Human ZNF57 cell lysate | +Inquiry |
AHNAK-8963HCL | Recombinant Human AHNAK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket