Recombinant Full Length Human Parainfluenza 3 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL6181HF |
Product Overview : | Recombinant Full Length Human parainfluenza 3 virus Hemagglutinin-neuraminidase(HN) Protein (P12562) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV3 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MEYWKHTNHGKDAGNELETSMATHGNKLTNKIIYILWTIILVLLSIVFIIVLTNSIKSEK AHESLLRDINNEFIGITEKIQMASDNTNDLIQSGVNTRLLTIQSHVQNYIPISLTQQMSD LRKFISEITIRNDNQEVLPQRITHDVGIKPLNPDDFWRCTSGLPSLMKTPKIRLMPGPGL LAMPTTVDGCIRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLN PRISHTFNINDNRKSCSLALLNTDVYQLCSTPKVDERSDYASSGIEDIVLDIVNYDGSIS TTRFKNNNISFDQPYAALYPSVGPGIYYKGKIIFLGYGGLEHPIDENVICNTTGCPGKTQ RDCNQASHSPWFSDRRMVNSIIVVDKGLNSTPKLKVWTISMRQNYWGSEGRLLLLGNKIY IYTRSTSWHSKLQLGIIDITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTD AYPLNPTGSIVSSVILDSQKSRVNPVITYSTATERVNELAIRNRTLSAGYTTTSCITHYN KGYCFHIVEINHKSSNTFQPMLFKTEIPKSCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12562 |
◆ Native Proteins | ||
FABP-174M | Native Cynomolgus Monkey Fatty acid Binding Protein | +Inquiry |
LTA-14S | Native S. aureus LTA Protein | +Inquiry |
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
Lectin-1732D | Active Native Dolichos Biflorus Agglutinin Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC5-7445HCL | Recombinant Human CLIC5 293 Cell Lysate | +Inquiry |
PRKAR1B-2862HCL | Recombinant Human PRKAR1B 293 Cell Lysate | +Inquiry |
LPIN2-4667HCL | Recombinant Human LPIN2 293 Cell Lysate | +Inquiry |
OSTF1-3520HCL | Recombinant Human OSTF1 293 Cell Lysate | +Inquiry |
Orange-391P | Plant Plant: Orange Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket