Recombinant Full Length Human Parainfluenza 3 Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL8443HF |
Product Overview : | Recombinant Full Length Human parainfluenza 3 virus Hemagglutinin-neuraminidase(HN) Protein (P08492) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | HPIV3 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MEYWKHTNHGKDAGNELETSMATHGNKITNKITYILWTIILVLLSIVFIIVLINSIKSEK AHESLLQDVNNEFMEVTEKIQMASDNINDLIQSGVNTRLLTIQSHVQNYIPISLTQQMSD LRKFISEITIRNDNQEVPPQRITHDVGIKPLNPDDFWRCTSGLPSLMKTPKIRLMPGPGL LAMPTTVDGCVRTPSLVINDLIYAYTSNLITRGCQDIGKSYQVLQIGIITVNSDLVPDLN PRISHTFNINDNRKSCSLALLNTDVYQLCSTPKVDERSDYASSGIEDIVLDIVNHDGSIS TTRFKNNNISFDQPYAALYPSVGPGIYYKGKIIFLGYGGLEHPINENAICNTTGCPGKTQ RDCNQASHSPWFSDRRMVNSIIVVDKGLNSIPKLKVWTISMRQNYWGSEGRLLLLGNKIY IYTRSTSWHSKLQLGIIDITDYSDIRIKWTWHNVLSRPGNNECPWGHSCPDGCITGVYTD AYPLNPTGSIVSSVILDSQKSRVNPVITYSTSTERVNELAIRNKTLSAGYTTTSCITHYN KGYCFHIVEINHKSLDTFQPMLFKTEIPKSCS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P08492 |
◆ Recombinant Proteins | ||
UBE2V1-3527Z | Recombinant Zebrafish UBE2V1 | +Inquiry |
ZDHHC3-642HF | Recombinant Full Length Human ZDHHC3 Protein, GST-tagged | +Inquiry |
PPA2-13153M | Recombinant Mouse PPA2 Protein | +Inquiry |
RFL10204SF | Recombinant Full Length Inner Membrane Protein Yban(Yban) Protein, His-Tagged | +Inquiry |
CPEB1-2624H | Recombinant Human CPEB1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
FGG -44D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
C3-8391H | Native Human C3 | +Inquiry |
SHBG-5519H | Native Human Sex Hormone-Binding Globulin | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDRG1-3320HCL | Recombinant Human PDRG1 293 Cell Lysate | +Inquiry |
TLK2-001HCL | Recombinant Human TLK2 cell lysate | +Inquiry |
MRPL49-4160HCL | Recombinant Human MRPL49 293 Cell Lysate | +Inquiry |
BAIAP2-8522HCL | Recombinant Human BAIAP2 293 Cell Lysate | +Inquiry |
CASD1-7842HCL | Recombinant Human CASD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket