Recombinant Full Length Schizosaccharomyces Pombe Uncharacterized Protein Slp1(Slp1) Protein, His-Tagged
Cat.No. : | RFL34814SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Uncharacterized protein slp1(slp1) Protein (O59729) (26-659aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-659) |
Form : | Lyophilized powder |
AA Sequence : | SPQTSHWCKYPALCLKSPDTHNENLVCDAYLSVIATKSEEKEASNPTTWDFTPTNKYQEP SFHTKTSLNGSDTISSNFLSKYEYSNGTSTSEFIDSISPPLVNETSTISSSKKLEQNYSV TEVIDTNIITSSSVTLPISEDGSSTSAAATIDSNIDEKTVAFSEEKRFNFASTDCAAAVI KTNPEAVGSSSILTENKDKYMLNKCSAENKFVVIELCEDIYVDTVQIANFEFFSSIFRDF KVSVSGKYPKYESSWMELGTFTALNLRTLQSFHIENPLIWAKYLKIEFLTHYGSEFYCPV SLLRVYGKTMIEEFEEANEDFLEQKVNDGSAIKADEIRKPQESPIFVDEEDTDVQSKPVR KNPSVELNSTDTLLSSTVISKSLSTVVIGNETGKSESYPATSTRSFNDISPSSSSSYSTA QISTFPSNQESIYKNINKRLSTLEERKKAFDEIVEKILTNYGKHNAKNMNFTQLLHELNS TLQLEISKLSKSVVKPSLFALQAKLELLSAENEYFQSQITSLYQESSFQKRLLMLQLTVL IVLTVYMAVSRLPENLPTTRSSSNNPIEASRPPFSRDEQDISKANDFRVSASSAVYTVGP ELLQRKKRDPNTSIRSIHEREQDKIIHSRSHSVC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPBC3E7.09 |
Synonyms | SPBC3E7.09; Uncharacterized protein slp1; SUN-like protein 1 |
UniProt ID | O59729 |
◆ Recombinant Proteins | ||
CDC42EP2-1281R | Recombinant Rat CDC42EP2 Protein | +Inquiry |
PLIN2-23H | Recombinant Human PLIN2 Protein (444 AA), N-8×His tagged | +Inquiry |
RFL30509HF | Recombinant Full Length Human Beta-1,4-Galactosyltransferase 4(B4Galt4) Protein, His-Tagged | +Inquiry |
ORMDL1-6409M | Recombinant Mouse ORMDL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNMA1-2185R | Recombinant Rhesus Macaque KCNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
gGT-184B | Active Native Bovine Gamma-Glutamyl Transferase | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
TTR-141S | Native Sheep prealbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C19orf60-93HCL | Recombinant Human C19orf60 lysate | +Inquiry |
ULK3-1883HCL | Recombinant Human ULK3 cell lysate | +Inquiry |
MRPL33-4179HCL | Recombinant Human MRPL33 293 Cell Lysate | +Inquiry |
GYPE-5671HCL | Recombinant Human GYPE 293 Cell Lysate | +Inquiry |
LILRB3-1653MCL | Recombinant Mouse LILRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All SPBC3E7.09 Products
Required fields are marked with *
My Review for All SPBC3E7.09 Products
Required fields are marked with *
0
Inquiry Basket