Recombinant Full Length Human Beta-1,4-Galactosyltransferase 4(B4Galt4) Protein, His-Tagged
Cat.No. : | RFL30509HF |
Product Overview : | Recombinant Full Length Human Beta-1,4-galactosyltransferase 4(B4GALT4) Protein (O60513) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | B4GALT4 |
Synonyms | B4GALT4; UNQ552/PRO1109; Beta-1,4-galactosyltransferase 4; Beta-1,4-GalTase 4; Beta4Gal-T4; b4Gal-T4; Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase; Lactotriaosylceramide beta-1,4-galactosyltransferase; N-acetyllactosamine synthase; |
UniProt ID | O60513 |
◆ Recombinant Proteins | ||
B4GALT4-392H | Recombinant Human B4GALT4 protein, His-tagged | +Inquiry |
B4GALT4-2643H | Recombinant Human B4GALT4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B4GALT4-922R | Recombinant Rat B4GALT4 Protein | +Inquiry |
B4GALT4-1743HF | Recombinant Full Length Human B4GALT4 Protein, GST-tagged | +Inquiry |
B4GALT4-0250H | Recombinant Human B4GALT4 Protein (Gln39-Ala344), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B4GALT4-8537HCL | Recombinant Human B4GALT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B4GALT4 Products
Required fields are marked with *
My Review for All B4GALT4 Products
Required fields are marked with *
0
Inquiry Basket