Recombinant Full Length Salmonella Typhimurium Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL6972SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q8ZQE4) (1-648aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-648) |
Form : | Lyophilized powder |
AA Sequence : | MTALLELCNVSRSYPSGEEQVAVLKDISLQIHAGEMVAIVGVSGSGKSTLMNILGCLDKP TSGTYRVAGRDVSTLDPDALAQLRREHFGFIFQRYHLLSHLTAAQNVEIPAVYAGIERKK RQARARELLLRLGLSDRVDYPPSQLSGGQQQRVSIARALMNGGQVILADEPTGALDSHSG EEVMAILRQLRDRGHTVIIVTHDPLIAAQAERIIEIHDGKIVHNPPAQEKKREQGVDAAV VNTAPGWRQFASSFREALSMAWLAMAANKMRTLLTMLGIIIGIASVVSIVVVGDAAKQMV LADIRAMGTNTIDIHPGKDFGDDNPQYRQALKYDDLVAIQKQPWVNSATPSVSKSLRLRY GNIDIAVNANGVSGDYFNVYGMSFREGNTFNAVQQQDRAQVVVLDANTRRQLFPNKANVV GEVVLAGNMPVIVIGVAEEKPSMYGNSNLLQVWLPYSTMSDRIMGQSWLNSITVRVKDGV DSDQAEQQLTRLLTLRHGKKDFFTWNMDSVLKTAEKTTYTLQLFLTLVAVISLVVGGIGV MNIMLVSVTERTREIGIRMAVGARASDVLQQFLIEAVLVCLVGGALGISLSMFIAFMLQL FLPGWEIGFSLTALASAFLCSTFTGILFGWLPARNAARLDPVDALARE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; STM0942; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q8ZQE4 |
◆ Recombinant Proteins | ||
NCF4-3336C | Recombinant Chicken NCF4 | +Inquiry |
DUSP8-2947H | Recombinant Human DUSP8 Protein, GST-tagged | +Inquiry |
RFL3824AF | Recombinant Full Length African Swine Fever Virus Transmembrane Protein Ep84R (Mal-062) Protein, His-Tagged | +Inquiry |
SUMO3-6320H | Recombinant Full Length Human SUMO3 Protein (Met1-Phe103) | +Inquiry |
Eng-10540M | Recombinant Mouse Eng Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
GG-187B | Native Bovine Gamma Globulin protein | +Inquiry |
COL3A1-001H | Native Human COL3A1 Protein | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBLN1-598HCL | Recombinant Human FBLN1 cell lysate | +Inquiry |
RBM12-2480HCL | Recombinant Human RBM12 293 Cell Lysate | +Inquiry |
PIK3R5-3182HCL | Recombinant Human PIK3R5 293 Cell Lysate | +Inquiry |
LRPAP1-2168MCL | Recombinant Mouse LRPAP1 cell lysate | +Inquiry |
IL2RB-741CCL | Recombinant Canine IL2RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket