Recombinant Full Length Burkholderia Pseudomallei Macrolide Export Atp-Binding/Permease Protein Macb(Macb) Protein, His-Tagged
Cat.No. : | RFL29203BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Macrolide export ATP-binding/permease protein MacB(macB) Protein (Q63MM6) (1-653aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-653) |
Form : | Lyophilized powder |
AA Sequence : | MTGPLLQLTRVTRRFPAGEKDVVVLDDVSLSIDAGEIVAIVGASGSGKSTLMNILGCLDH PSSGSYTVGGRETSELESDELARLRREHFGFIFQRYHLLPHLCAAENVEMPAVYAGSAQA QRRERALALLARLGLSDRASHRPSQLSGGQQQRVSIARALMNGGEVILADEPTGALDSKS GRDVIRVLRELNALGHTVIIVTHDEQVAAHARRIIEISDGRIVGDRLNPHADAADAAPDA SGGAQPQRARRLSAGVGRFAEAFRMAWIALVSHRLRTLLTMLGIIIGITSVVSIVAIGEG AKRYMLDEIGSIGTNTINVYPGADWGDSRADAIQTLVAADAAALADQIYIDSATPETSRS LLLRYRNVDVNALVSGVGERFFQVRGMKLAQGIAFGADEVRRQAQVAVIDENTRRKLFGA NPNPLGEVILIDNLPCVVIGVTASKKSAFGDMKNLNVWVPYTTASGRLFGQRHLDSITVR VRDGQPSDAAERSLTKLMLQRHGRKDFFTYNMDSVVKTVEKTGQSLTLLLSLIAVISLVV GGIGVMNIMLVSVTERTREIGIRMAVGARQTDIMQQFLVEAVTVCLMGGAIGIVLSFGMS FVFSLFVDQWKMVFSAASIASAFLCSTLIGVVFGFMPARNASRLDPIDALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB |
Synonyms | macB; BPSS0624; Macrolide export ATP-binding/permease protein MacB |
UniProt ID | Q63MM6 |
◆ Recombinant Proteins | ||
AP1B1-644H | Recombinant Human AP1B1 protein, GST-tagged | +Inquiry |
ERGIC3-241C | Recombinant Cynomolgus Monkey ERGIC3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL16-126H | Active Recombinant Human IL16 protein | +Inquiry |
SPINK14-5371R | Recombinant Rat SPINK14 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPT-169H | Recombinant Human Tau-441 (151-391) | +Inquiry |
◆ Native Proteins | ||
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL4-6274HCL | Recombinant Human FCRL4 293 Cell Lysate | +Inquiry |
BFSP1-64HCL | Recombinant Human BFSP1 lysate | +Inquiry |
ZBTB5-212HCL | Recombinant Human ZBTB5 293 Cell Lysate | +Inquiry |
GLA-2173HCL | Recombinant Human GLA cell lysate | +Inquiry |
LIPI-989HCL | Recombinant Human LIPI cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All macB Products
Required fields are marked with *
My Review for All macB Products
Required fields are marked with *
0
Inquiry Basket